Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ParE-CopA/ParE-RHH |
Location | 488516..489090 | Replicon | plasmid 3 |
Accession | NZ_LR594668 | ||
Organism | Variovorax sp. SRS16 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | E5P2_RS34570 | Protein ID | WP_162571554.1 |
Coordinates | 488516..488812 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | copA | Uniprot ID | - |
Locus tag | E5P2_RS34575 | Protein ID | WP_162571555.1 |
Coordinates | 488800..489090 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E5P2_RS34545 | 484511..485749 | + | 1239 | WP_162571549.1 | DUF4942 domain-containing protein | - |
E5P2_RS34550 | 485866..486147 | + | 282 | WP_162571550.1 | hypothetical protein | - |
E5P2_RS34555 | 486287..486595 | + | 309 | WP_162571551.1 | transcriptional regulator | - |
E5P2_RS34560 | 486711..487748 | + | 1038 | WP_162571552.1 | ParB/RepB/Spo0J family partition protein | - |
E5P2_RS34565 | 487955..488332 | + | 378 | WP_162571553.1 | conjugal transfer protein TraO | - |
E5P2_RS34570 | 488516..488812 | - | 297 | WP_162571554.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
E5P2_RS34575 | 488800..489090 | - | 291 | WP_162571555.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
E5P2_RS34580 | 489189..489635 | - | 447 | WP_162571556.1 | conjugal transfer protein TraM | - |
E5P2_RS34585 | 489635..490360 | - | 726 | WP_162571557.1 | conjugal transfer protein TraL | - |
E5P2_RS34590 | 490360..490836 | - | 477 | WP_162571558.1 | TraK family protein | - |
E5P2_RS34595 | 491114..491488 | + | 375 | WP_162571559.1 | conjugal transfer protein TrbJ | - |
E5P2_RS34600 | 491523..493787 | + | 2265 | WP_162571560.1 | relaxase/mobilization nuclease domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..560632 | 560632 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11187.86 Da Isoelectric Point: 8.0182
>T288578 WP_162571554.1 NZ_LR594668:c488812-488516 [Variovorax sp. SRS16]
MPRLIWSPHALSDVQRLYRFLCGKNPDAARRAVRTIRDGMMVVAQQPGIGRPIADMEPEYREWLIDFGAGGYVAKYRLDG
ETAVVLAVRHQREVGYEE
MPRLIWSPHALSDVQRLYRFLCGKNPDAARRAVRTIRDGMMVVAQQPGIGRPIADMEPEYREWLIDFGAGGYVAKYRLDG
ETAVVLAVRHQREVGYEE
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|