Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 151536..152103 Replicon plasmid 3
Accession NZ_LR594668
Organism Variovorax sp. SRS16

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag E5P2_RS32915 Protein ID WP_162571278.1
Coordinates 151536..151907 (-) Length 124 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag E5P2_RS32920 Protein ID WP_162571279.1
Coordinates 151894..152103 (-) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E5P2_RS32875 146999..147874 + 876 WP_162571273.1 universal stress protein -
E5P2_RS32880 148082..148258 - 177 Protein_145 IS6 family transposase -
E5P2_RS32885 148337..148684 + 348 Protein_146 IS110 family transposase -
E5P2_RS32890 148729..148938 + 210 Protein_147 DDE-type integrase/transposase/recombinase -
E5P2_RS32895 149300..150423 + 1124 WP_162571274.1 IS3 family transposase -
E5P2_RS32900 150502..150822 - 321 WP_162571275.1 type II toxin-antitoxin system PemK/MazF family toxin -
E5P2_RS32905 150816..151070 - 255 WP_162571276.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
E5P2_RS32910 151344..151487 + 144 WP_162571277.1 hypothetical protein -
E5P2_RS32915 151536..151907 - 372 WP_162571278.1 PIN domain nuclease Toxin
E5P2_RS32920 151894..152103 - 210 WP_162571279.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
E5P2_RS32925 152353..152619 - 267 WP_162571280.1 BrnA antitoxin family protein -
E5P2_RS32930 152603..152902 - 300 WP_162571281.1 BrnT family toxin -
E5P2_RS32935 153001..154152 - 1152 WP_162571282.1 site-specific integrase -
E5P2_RS32940 154279..155322 + 1044 WP_162571283.1 DNA-binding protein -
E5P2_RS32945 155667..156110 + 444 WP_162571284.1 hypothetical protein -
E5P2_RS32950 156293..156859 + 567 WP_162571285.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..560632 560632
- flank IS/Tn - - 149300..149566 266


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-46)


Sequences

Toxin        


Download         Length: 124 a.a.        Molecular weight: 13625.80 Da        Isoelectric Point: 4.8450

>T288577 WP_162571278.1 NZ_LR594668:c151907-151536 [Variovorax sp. SRS16]
MILVDTSVWIDHLARSDSQLQSLLEEGEILMHPYIVAEIALGSLPQRDETVGALQALPEIPLAQHVEVMAFLDNEKLFGI
GIGYVDLHLLAATRLAAGTRLWTRDRRLLQAALRLDLAAFASR

Download         Length: 372 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 7664.65 Da        Isoelectric Point: 11.5000

>AT288577 WP_162571279.1 NZ_LR594668:c152103-151894 [Variovorax sp. SRS16]
MRTTVTLDDELLSQARTFTGIQENSALIQQALRSLVQREAARRLARLGGSAPHLEAPPRRRGEVADDPR

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References