Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /RES-TIGR02293 |
| Location | 5252913..5253628 | Replicon | chromosome |
| Accession | NZ_LR594666 | ||
| Organism | Variovorax sp. SRS16 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | E5P2_RS25355 | Protein ID | WP_162569855.1 |
| Coordinates | 5252913..5253365 (-) | Length | 151 a.a. |
Antitoxin (Protein)
| Gene name | PrcA | Uniprot ID | - |
| Locus tag | E5P2_RS25360 | Protein ID | WP_162569856.1 |
| Coordinates | 5253365..5253628 (-) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E5P2_RS25335 | 5248212..5249477 | + | 1266 | WP_174262699.1 | cation:proton antiporter | - |
| E5P2_RS25340 | 5249513..5250637 | + | 1125 | WP_162570663.1 | glutamate--cysteine ligase | - |
| E5P2_RS25345 | 5250645..5251628 | + | 984 | WP_162569853.1 | thiamine-phosphate kinase | - |
| E5P2_RS25350 | 5251671..5252831 | - | 1161 | WP_162569854.1 | MFS transporter | - |
| E5P2_RS25355 | 5252913..5253365 | - | 453 | WP_162569855.1 | RES family NAD+ phosphorylase | Toxin |
| E5P2_RS25360 | 5253365..5253628 | - | 264 | WP_162569856.1 | DUF2384 domain-containing protein | Antitoxin |
| E5P2_RS25365 | 5253721..5254647 | + | 927 | WP_162569857.1 | LysR family transcriptional regulator | - |
| E5P2_RS25370 | 5254681..5255382 | + | 702 | WP_162569858.1 | phosphatase PAP2 family protein | - |
| E5P2_RS25375 | 5255379..5255618 | + | 240 | WP_162569859.1 | acyl carrier protein | - |
| E5P2_RS25380 | 5255615..5256817 | + | 1203 | WP_162569860.1 | beta-ketoacyl-[acyl-carrier-protein] synthase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 151 a.a. Molecular weight: 16047.52 Da Isoelectric Point: 9.4319
>T288575 WP_162569855.1 NZ_LR594666:c5253365-5252913 [Variovorax sp. SRS16]
MRVYRISKAVHVATALSGQGAALYAGRWKSRGVRLAYMAGSAALAMLELLVHVDKEDAPTGLRLLSYELPDDAVQPLHAL
PPGWSALPYSPAVQAVGDRWIASGRSLALRVPSAVARHESNVLVNPGHARFAEIALVADETLTLDARLFA
MRVYRISKAVHVATALSGQGAALYAGRWKSRGVRLAYMAGSAALAMLELLVHVDKEDAPTGLRLLSYELPDDAVQPLHAL
PPGWSALPYSPAVQAVGDRWIASGRSLALRVPSAVARHESNVLVNPGHARFAEIALVADETLTLDARLFA
Download Length: 453 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|