Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | FicTA/Fic(toxin) |
Location | 3120..3913 | Replicon | plasmid 4 |
Accession | NZ_LR594665 | ||
Organism | Variovorax sp. RA8 |
Toxin (Protein)
Gene name | VbhT | Uniprot ID | Q6QHR6 |
Locus tag | E5P3_RS35320 | Protein ID | WP_011171676.1 |
Coordinates | 3305..3913 (+) | Length | 203 a.a. |
Antitoxin (Protein)
Gene name | VbhA | Uniprot ID | A0A8B6LZM3 |
Locus tag | E5P3_RS35315 | Protein ID | WP_011171677.1 |
Coordinates | 3120..3308 (+) | Length | 63 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E5P3_RS35300 | 1..774 | + | 774 | WP_162572150.1 | ParA family protein | - |
E5P3_RS35305 | 771..1844 | + | 1074 | WP_011171679.1 | ParB/RepB/Spo0J family partition protein | - |
E5P3_RS35310 | 2039..3055 | + | 1017 | WP_011171678.1 | DNA-binding protein | - |
E5P3_RS35315 | 3120..3308 | + | 189 | WP_011171677.1 | antitoxin VbhA family protein | Antitoxin |
E5P3_RS35320 | 3305..3913 | + | 609 | WP_011171676.1 | Fic/DOC family protein | Toxin |
E5P3_RS35325 | 3930..4274 | + | 345 | WP_015063536.1 | hypothetical protein | - |
E5P3_RS35330 | 4326..4955 | + | 630 | WP_162572165.1 | hypothetical protein | - |
E5P3_RS35335 | 5026..5463 | - | 438 | WP_011171734.1 | conjugal transfer protein TraM | - |
E5P3_RS35340 | 5463..6188 | - | 726 | WP_011171733.1 | conjugal transfer protein TraL | - |
E5P3_RS35345 | 6188..6586 | - | 399 | WP_011171732.1 | TraK family protein | - |
E5P3_RS35350 | 7011..7367 | + | 357 | WP_162572166.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..68393 | 68393 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 203 a.a. Molecular weight: 22398.22 Da Isoelectric Point: 7.4661
>T288573 WP_011171676.1 NZ_LR594665:3305-3913 [Variovorax sp. RA8]
MKYAGDRGDPYLDSETGVLRNLLGIKEQGGLDKAESTLSFLRASELREQPVKGKFDLAHLQRIHKRLFGDVYDWAGQIRQ
VEISKGSTMFARQVAIQSAAQQLFGQLAKEQLLRGLDADEFSKRAGHYLGEINVLHPFREGNGRTQREFIGQLAQQAGHR
IDWSGVSQASMTQASIEAYNGDSSGMAGLIRAGMPDQLFFNP
MKYAGDRGDPYLDSETGVLRNLLGIKEQGGLDKAESTLSFLRASELREQPVKGKFDLAHLQRIHKRLFGDVYDWAGQIRQ
VEISKGSTMFARQVAIQSAAQQLFGQLAKEQLLRGLDADEFSKRAGHYLGEINVLHPFREGNGRTQREFIGQLAQQAGHR
IDWSGVSQASMTQASIEAYNGDSSGMAGLIRAGMPDQLFFNP
Download Length: 609 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A8B6M0K6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A8B6LZM3 |