Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 250566..251146 | Replicon | plasmid 2 |
Accession | NZ_LR594663 | ||
Organism | Variovorax sp. RA8 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | E5P3_RS32175 | Protein ID | WP_162590122.1 |
Coordinates | 250566..250904 (-) | Length | 113 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | E5P3_RS32180 | Protein ID | WP_162590123.1 |
Coordinates | 250904..251146 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E5P3_RS32145 | 245641..245937 | - | 297 | WP_162590278.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
E5P3_RS32150 | 245934..246242 | - | 309 | WP_162590279.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
E5P3_RS32155 | 246400..246807 | - | 408 | WP_162590120.1 | hypothetical protein | - |
E5P3_RS32160 | 247161..247697 | - | 537 | Protein_245 | hypothetical protein | - |
E5P3_RS32165 | 247737..248015 | - | 279 | Protein_246 | transposase domain-containing protein | - |
E5P3_RS32170 | 248470..249885 | - | 1416 | WP_162590121.1 | transposase | - |
E5P3_RS32175 | 250566..250904 | - | 339 | WP_162590122.1 | endoribonuclease MazF | Toxin |
E5P3_RS32180 | 250904..251146 | - | 243 | WP_162590123.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
E5P3_RS32185 | 251627..252610 | + | 984 | WP_162590124.1 | TIM barrel protein | - |
E5P3_RS32190 | 252607..253581 | + | 975 | WP_162590125.1 | tripartite tricarboxylate transporter substrate binding protein | - |
E5P3_RS32195 | 253803..254765 | + | 963 | WP_162590126.1 | LysR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..428971 | 428971 | |
- | flank | IS/Tn | - | - | 248470..249885 | 1415 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 11990.90 Da Isoelectric Point: 10.2289
>T288571 WP_162590122.1 NZ_LR594663:c250904-250566 [Variovorax sp. RA8]
MVRRYVPEAGDIVWLHFDPQAGHEQAGHRPALVLSPSAYNGKTGLMLCCPLTTQVKGYPFEVKIAAARAGAALADQVKSL
DWVARRASRKGRASAAELAEVRAKAIALIGQP
MVRRYVPEAGDIVWLHFDPQAGHEQAGHRPALVLSPSAYNGKTGLMLCCPLTTQVKGYPFEVKIAAARAGAALADQVKSL
DWVARRASRKGRASAAELAEVRAKAIALIGQP
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|