Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-RelB |
| Location | 245641..246242 | Replicon | plasmid 2 |
| Accession | NZ_LR594663 | ||
| Organism | Variovorax sp. RA8 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | E5P3_RS32145 | Protein ID | WP_162590278.1 |
| Coordinates | 245641..245937 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | E5P3_RS32150 | Protein ID | WP_162590279.1 |
| Coordinates | 245934..246242 (-) | Length | 103 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E5P3_RS32125 | 241792..242649 | + | 858 | WP_162590117.1 | hypothetical protein | - |
| E5P3_RS32130 | 243236..243586 | - | 351 | WP_162590118.1 | hypothetical protein | - |
| E5P3_RS32135 | 243846..244109 | + | 264 | WP_162590119.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| E5P3_RS32140 | 244189..245583 | + | 1395 | Protein_241 | IS66 family transposase | - |
| E5P3_RS32145 | 245641..245937 | - | 297 | WP_162590278.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| E5P3_RS32150 | 245934..246242 | - | 309 | WP_162590279.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| E5P3_RS32155 | 246400..246807 | - | 408 | WP_162590120.1 | hypothetical protein | - |
| E5P3_RS32160 | 247161..247697 | - | 537 | Protein_245 | hypothetical protein | - |
| E5P3_RS32165 | 247737..248015 | - | 279 | Protein_246 | transposase domain-containing protein | - |
| E5P3_RS32170 | 248470..249885 | - | 1416 | WP_162590121.1 | transposase | - |
| E5P3_RS32175 | 250566..250904 | - | 339 | WP_162590122.1 | endoribonuclease MazF | - |
| E5P3_RS32180 | 250904..251146 | - | 243 | WP_162590123.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..428971 | 428971 | |
| - | flank | IS/Tn | - | - | 248470..249885 | 1415 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11299.03 Da Isoelectric Point: 5.8792
>T288570 WP_162590278.1 NZ_LR594663:c245937-245641 [Variovorax sp. RA8]
VRLEWSPLAMDDRERIFDFIERDDPRAAIAVDERIATQVLVLLQFPEGGRPGRVEGTRELVVRRTSYIVAYRVGKDCVRI
LRILHSAQLWPGELTDLP
VRLEWSPLAMDDRERIFDFIERDDPRAAIAVDERIATQVLVLLQFPEGGRPGRVEGTRELVVRRTSYIVAYRVGKDCVRI
LRILHSAQLWPGELTDLP
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|