Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapB(antitoxin) |
Location | 138503..139080 | Replicon | plasmid 2 |
Accession | NZ_LR594663 | ||
Organism | Variovorax sp. RA8 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | E5P3_RS31660 | Protein ID | WP_162590069.1 |
Coordinates | 138706..139080 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | E5P3_RS31655 | Protein ID | WP_162590273.1 |
Coordinates | 138503..138709 (+) | Length | 69 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E5P3_RS31640 | 133590..134576 | + | 987 | WP_162590272.1 | D-2-hydroxyacid dehydrogenase family protein | - |
E5P3_RS31645 | 135643..136648 | - | 1006 | Protein_142 | CoA transferase | - |
E5P3_RS31650 | 137033..138148 | - | 1116 | WP_162590068.1 | DNA-binding protein | - |
E5P3_RS31655 | 138503..138709 | + | 207 | WP_162590273.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
E5P3_RS31660 | 138706..139080 | + | 375 | WP_162590069.1 | VapC toxin family PIN domain ribonuclease | Toxin |
E5P3_RS31665 | 139089..139922 | + | 834 | WP_162590070.1 | integrase | - |
E5P3_RS31670 | 139919..141016 | - | 1098 | WP_024815569.1 | DNA-binding protein | - |
E5P3_RS31675 | 141295..141598 | + | 304 | Protein_148 | type II toxin-antitoxin system RelE/ParE family toxin | - |
E5P3_RS31680 | 141664..141993 | + | 330 | WP_024815568.1 | helix-turn-helix domain-containing protein | - |
E5P3_RS31685 | 142094..142318 | - | 225 | Protein_150 | hypothetical protein | - |
E5P3_RS31690 | 143087..143553 | + | 467 | Protein_151 | heme-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..428971 | 428971 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13530.72 Da Isoelectric Point: 6.2063
>T288569 WP_162590069.1 NZ_LR594663:138706-139080 [Variovorax sp. RA8]
MSVLVDTSVWIDHFRSGNAALAHLVGLDLALTHPMVVVELACGTPPTPREHTLGGLSLLRTCNQATLNEVQELVERERLY
GLGCGLVDMALLASTLITPGARLWTLDRRLLELAQRFDVAHGIH
MSVLVDTSVWIDHFRSGNAALAHLVGLDLALTHPMVVVELACGTPPTPREHTLGGLSLLRTCNQATLNEVQELVERERLY
GLGCGLVDMALLASTLITPGARLWTLDRRLLELAQRFDVAHGIH
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|