Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-MazE |
Location | 111511..112156 | Replicon | plasmid 2 |
Accession | NZ_LR594663 | ||
Organism | Variovorax sp. RA8 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | E5P3_RS31530 | Protein ID | WP_162590046.1 |
Coordinates | 111511..111936 (-) | Length | 142 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | E5P3_RS31535 | Protein ID | WP_162590047.1 |
Coordinates | 111926..112156 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E5P3_RS31515 | 106558..107004 | - | 447 | WP_162590271.1 | Lrp/AsnC family transcriptional regulator | - |
E5P3_RS31520 | 107170..110670 | + | 3501 | WP_162590044.1 | indolepyruvate ferredoxin oxidoreductase family protein | - |
E5P3_RS31525 | 110689..111012 | + | 324 | WP_162590045.1 | hypothetical protein | - |
E5P3_RS31530 | 111511..111936 | - | 426 | WP_162590046.1 | PIN domain-containing protein | Toxin |
E5P3_RS31535 | 111926..112156 | - | 231 | WP_162590047.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
E5P3_RS31540 | 112847..113071 | - | 225 | WP_162590048.1 | exodeoxyribonuclease VII | - |
E5P3_RS31545 | 113254..114846 | - | 1593 | WP_162590049.1 | exodeoxyribonuclease VII large subunit | - |
E5P3_RS31550 | 115062..115604 | - | 543 | WP_162590050.1 | helix-turn-helix transcriptional regulator | - |
E5P3_RS31555 | 115833..116231 | - | 399 | WP_162590051.1 | VOC family protein | - |
E5P3_RS31560 | 116585..116857 | + | 273 | WP_162590052.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..428971 | 428971 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15767.27 Da Isoelectric Point: 5.2253
>T288568 WP_162590046.1 NZ_LR594663:c111936-111511 [Variovorax sp. RA8]
MKDRAFADTNVVLYMMSKDAAKAERARAVVAGRPIISVQVLNEIANVARRKLTLPWKEIDEFLQLVRGLCPVEPLTVESH
DLGRALSEKYQLSVYDSMILSSALLSGCDTLYSEDMQDSLRIEKTLTIVNPFSLYGPNFAL
MKDRAFADTNVVLYMMSKDAAKAERARAVVAGRPIISVQVLNEIANVARRKLTLPWKEIDEFLQLVRGLCPVEPLTVESH
DLGRALSEKYQLSVYDSMILSSALLSGCDTLYSEDMQDSLRIEKTLTIVNPFSLYGPNFAL
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|