Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
| Location | 418962..419544 | Replicon | chromosome |
| Accession | NZ_LR594051 | ||
| Organism | Enterococcus faecalis strain NCTC8732 | ||
Toxin (Protein)
| Gene name | zeta | Uniprot ID | A0A0M2AE74 |
| Locus tag | FGL29_RS02275 | Protein ID | WP_002355414.1 |
| Coordinates | 419236..419544 (+) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | epsilon | Uniprot ID | Q9AL19 |
| Locus tag | FGL29_RS02270 | Protein ID | WP_002326825.1 |
| Coordinates | 418962..419234 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FGL29_RS02235 | 414243..414971 | - | 729 | WP_002355404.1 | GntR family transcriptional regulator | - |
| FGL29_RS02240 | 415148..416074 | + | 927 | WP_002355406.1 | hypothetical protein | - |
| FGL29_RS02245 | 416091..417374 | + | 1284 | WP_002363033.1 | PTS sugar transporter subunit IIC | - |
| FGL29_RS02255 | 417566..417688 | + | 123 | Protein_395 | topoisomerase | - |
| FGL29_RS02260 | 417763..418659 | + | 897 | WP_002363034.1 | ParA family protein | - |
| FGL29_RS02265 | 418736..418945 | + | 210 | WP_002363035.1 | peptide-binding protein | - |
| FGL29_RS02270 | 418962..419234 | + | 273 | WP_002326825.1 | antitoxin | Antitoxin |
| FGL29_RS02275 | 419236..419544 | + | 309 | WP_002355414.1 | zeta toxin family protein | Toxin |
| FGL29_RS02280 | 419624..420052 | - | 429 | WP_071623404.1 | tyrosine-type recombinase/integrase | - |
| FGL29_RS02285 | 420097..420597 | - | 501 | WP_002363039.1 | HAD family hydrolase | - |
| FGL29_RS02290 | 420602..421369 | - | 768 | WP_002355416.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| FGL29_RS02300 | 421857..422282 | + | 426 | WP_002355418.1 | galactose-6-phosphate isomerase subunit LacA | - |
| FGL29_RS02305 | 422299..422814 | + | 516 | WP_002345825.1 | galactose-6-phosphate isomerase subunit LacB | - |
| FGL29_RS02310 | 422825..423757 | + | 933 | WP_002363040.1 | tagatose-6-phosphate kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | ClpL | bsh / esp / psaA | 386776..531093 | 144317 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11525.91 Da Isoelectric Point: 5.7251
>T288544 WP_002355414.1 NZ_LR594051:419236-419544 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M2AE74 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M2AF93 |