288541

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 2143962..2144448 Replicon chromosome
Accession NZ_LR594048
Organism Streptococcus dysgalactiae subsp. equisimilis strain NCTC11556

Toxin (Protein)


Gene name relE Uniprot ID Q48QR0
Locus tag FGL22_RS10565 Protein ID WP_014407961.1
Coordinates 2143962..2144231 (-) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A660A1J7
Locus tag FGL22_RS10570 Protein ID WP_014407962.1
Coordinates 2144221..2144448 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FGL22_RS10550 2139301..2141574 - 2274 WP_046178065.1 YhgE/Pip domain-containing protein -
FGL22_RS10555 2141709..2142242 + 534 WP_003059589.1 TetR/AcrR family transcriptional regulator C-terminal domain-containing protein -
FGL22_RS10560 2142270..2143634 - 1365 Protein_1996 IS1182 family transposase -
FGL22_RS10565 2143962..2144231 - 270 WP_014407961.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
FGL22_RS10570 2144221..2144448 - 228 WP_014407962.1 hypothetical protein Antitoxin
FGL22_RS10575 2144585..2144971 - 387 WP_138129493.1 ArpU family transcriptional regulator -
FGL22_RS10580 2144946..2145308 - 363 WP_046177962.1 DUF1492 domain-containing protein -
FGL22_RS10585 2145547..2145768 - 222 WP_046177979.1 hypothetical protein -
FGL22_RS10590 2145768..2146016 - 249 WP_100249571.1 hypothetical protein -
FGL22_RS10595 2146006..2146344 - 339 WP_037580661.1 hypothetical protein -
FGL22_RS10600 2146415..2146675 - 261 WP_046177963.1 hypothetical protein -
FGL22_RS10605 2146685..2147470 - 786 WP_046177964.1 hypothetical protein -
FGL22_RS10935 2147560..2147709 - 150 WP_162836006.1 hypothetical protein -
FGL22_RS10610 2147723..2147968 - 246 WP_015058152.1 hypothetical protein -
FGL22_RS10940 2147943..2148080 - 138 WP_158001818.1 hypothetical protein -
FGL22_RS10945 2148082..2148255 - 174 WP_046177965.1 hypothetical protein -
FGL22_RS10615 2148261..2148434 - 174 WP_046177966.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 2122064..2173224 51160
- flank IS/Tn - - 2142543..2143667 1124


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-87)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10497.50 Da        Isoelectric Point: 10.5027

>T288541 WP_014407961.1 NZ_LR594048:c2144231-2143962 [Streptococcus dysgalactiae subsp. equisimilis]
MTYKLVVSDEVKKQLKKMDKHVGLMLAKDMKKRLDGLNNPRQFGKALTGQYKGLWRYRVGNYRVICDIVDNEMIILALEV
GHRKEIYKR

Download         Length: 270 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8641.63 Da        Isoelectric Point: 3.9607

>AT288541 WP_014407962.1 NZ_LR594048:c2144448-2144221 [Streptococcus dysgalactiae subsp. equisimilis]
MAMVSLRLNSAEEELFRSYATHTGKTLSELFKTALAQQIEDQLDYETGIQALKRFEENPITYSIDDLIEELENDL

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A660A202

Antitoxin

Source ID Structure
AlphaFold DB A0A660A1J7

References