Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 285542..286154 | Replicon | chromosome |
Accession | NZ_LR594048 | ||
Organism | Streptococcus dysgalactiae subsp. equisimilis strain NCTC11556 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q8E1X3 |
Locus tag | FGL22_RS01560 | Protein ID | WP_000384858.1 |
Coordinates | 285542..285877 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q8E1X2 |
Locus tag | FGL22_RS01565 | Protein ID | WP_000255538.1 |
Coordinates | 285867..286154 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FGL22_RS01530 | 280562..280888 | + | 327 | WP_000384270.1 | replication initiator protein A | - |
FGL22_RS01535 | 280892..281521 | + | 630 | WP_000591148.1 | hypothetical protein | - |
FGL22_RS01540 | 281834..282709 | + | 876 | WP_000770113.1 | hypothetical protein | - |
FGL22_RS01545 | 282745..283179 | + | 435 | WP_001220479.1 | hypothetical protein | - |
FGL22_RS01550 | 283495..284715 | + | 1221 | Protein_253 | plasmid recombination protein | - |
FGL22_RS01555 | 284767..285237 | + | 471 | WP_000130119.1 | hypothetical protein | - |
FGL22_RS01560 | 285542..285877 | - | 336 | WP_000384858.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
FGL22_RS01565 | 285867..286154 | - | 288 | WP_000255538.1 | hypothetical protein | Antitoxin |
FGL22_RS01570 | 286559..287170 | - | 612 | WP_171842254.1 | tyrosine-type recombinase/integrase | - |
FGL22_RS01575 | 287302..288165 | - | 864 | WP_046177583.1 | IS982 family transposase | - |
FGL22_RS01585 | 288961..290899 | + | 1939 | Protein_259 | PTS sugar transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 287302..288165 | 863 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13264.04 Da Isoelectric Point: 5.2388
>T288538 WP_000384858.1 NZ_LR594048:c285877-285542 [Streptococcus dysgalactiae subsp. equisimilis]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQHKMEQIISDIEKLEVFPEVGFDADEKYGSKISKYHSTRGYTLSKD
YIVLYHIEEEENRVVIDYLLPTRSDYMKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQHKMEQIISDIEKLEVFPEVGFDADEKYGSKISKYHSTRGYTLSKD
YIVLYHIEEEENRVVIDYLLPTRSDYMKLFK
Download Length: 336 bp
Antitoxin
Download Length: 96 a.a. Molecular weight: 10921.47 Da Isoelectric Point: 4.7271
>AT288538 WP_000255538.1 NZ_LR594048:c286154-285867 [Streptococcus dysgalactiae subsp. equisimilis]
MVTAEKNRAVTFQANKELVSEAMTVLNKKNLTLSSALRLFLQNVVVTNEVDLLTEEELEKEKLFKQFQAEINKNIEDVRQ
GKFYTSEEVRSELGL
MVTAEKNRAVTFQANKELVSEAMTVLNKKNLTLSSALRLFLQNVVVTNEVDLLTEEELEKEKLFKQFQAEINKNIEDVRQ
GKFYTSEEVRSELGL
Download Length: 288 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E1EF10 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E1EFF9 |