Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelB(antitoxin) |
Location | 646419..647037 | Replicon | chromosome |
Accession | NZ_LR594047 | ||
Organism | Streptococcus dysgalactiae subsp. equisimilis strain NCTC11554 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | FGL21_RS03485 | Protein ID | WP_003058081.1 |
Coordinates | 646419..646760 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | FGL21_RS03490 | Protein ID | WP_003058067.1 |
Coordinates | 646750..647037 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FGL21_RS03465 | 641882..643126 | - | 1245 | WP_014612120.1 | site-specific integrase | - |
FGL21_RS03470 | 643137..643334 | - | 198 | WP_003058094.1 | transposase | - |
FGL21_RS03475 | 643354..644457 | - | 1104 | WP_014612121.1 | CHAP domain-containing protein | - |
FGL21_RS03480 | 644460..646361 | - | 1902 | WP_003058051.1 | hypothetical protein | - |
FGL21_RS03485 | 646419..646760 | - | 342 | WP_003058081.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
FGL21_RS03490 | 646750..647037 | - | 288 | WP_003058067.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
FGL21_RS03495 | 647108..649606 | - | 2499 | WP_003058044.1 | ATP-binding protein | - |
FGL21_RS03500 | 649590..650006 | - | 417 | WP_003058056.1 | conjugal transfer protein | - |
FGL21_RS03505 | 650015..650233 | - | 219 | WP_003058071.1 | hypothetical protein | - |
FGL21_RS03510 | 650230..651171 | - | 942 | WP_003058075.1 | conjugal transfer protein | - |
FGL21_RS03515 | 651184..651447 | - | 264 | WP_003058063.1 | hypothetical protein | - |
FGL21_RS03520 | 651457..651729 | - | 273 | WP_003058046.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | tufA | 599975..720751 | 120776 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13438.41 Da Isoelectric Point: 7.0067
>T288536 WP_003058081.1 NZ_LR594047:c646760-646419 [Streptococcus dysgalactiae subsp. equisimilis]
MAYNVQITKSAERDLDSIYQFYLDEFSEQSALKVIKSLQDAISFLYVSPLGYTDFDSKINRKIYPQGNLRMIPSKQYLIF
YLIREERVDVLRIIHSRTDYLNNLENLFKNLNL
MAYNVQITKSAERDLDSIYQFYLDEFSEQSALKVIKSLQDAISFLYVSPLGYTDFDSKINRKIYPQGNLRMIPSKQYLIF
YLIREERVDVLRIIHSRTDYLNNLENLFKNLNL
Download Length: 342 bp
Antitoxin
Download Length: 96 a.a. Molecular weight: 10869.33 Da Isoelectric Point: 4.3885
>AT288536 WP_003058067.1 NZ_LR594047:c647037-646750 [Streptococcus dysgalactiae subsp. equisimilis]
MNTLARDRQYNFRVNADMLNQAKEILEEKHMSLPDALNLFVEQVVVTKDLPIKTPEQVQAESFLNELISELDEGYQDVLK
GNTKPANEVFAKYGL
MNTLARDRQYNFRVNADMLNQAKEILEEKHMSLPDALNLFVEQVVVTKDLPIKTPEQVQAESFLNELISELDEGYQDVLK
GNTKPANEVFAKYGL
Download Length: 288 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|