Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelB(antitoxin) |
Location | 561071..561689 | Replicon | chromosome |
Accession | NZ_LR594045 | ||
Organism | Streptococcus dysgalactiae subsp. equisimilis strain NCTC9413 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | FGL14_RS03060 | Protein ID | WP_003058081.1 |
Coordinates | 561071..561412 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | FGL14_RS03065 | Protein ID | WP_138083747.1 |
Coordinates | 561402..561689 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FGL14_RS03040 | 556534..557778 | - | 1245 | WP_138083745.1 | site-specific integrase | - |
FGL14_RS03045 | 557789..557986 | - | 198 | WP_003058094.1 | transposase | - |
FGL14_RS03050 | 558006..559109 | - | 1104 | WP_046177356.1 | CHAP domain-containing protein | - |
FGL14_RS03055 | 559112..561013 | - | 1902 | WP_138083746.1 | hypothetical protein | - |
FGL14_RS03060 | 561071..561412 | - | 342 | WP_003058081.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
FGL14_RS03065 | 561402..561689 | - | 288 | WP_138083747.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
FGL14_RS03070 | 561760..564258 | - | 2499 | WP_138083748.1 | ATP-binding protein | - |
FGL14_RS03075 | 564242..564658 | - | 417 | WP_003058056.1 | conjugal transfer protein | - |
FGL14_RS03080 | 564667..564885 | - | 219 | WP_003058071.1 | hypothetical protein | - |
FGL14_RS03085 | 564882..565823 | - | 942 | WP_138083749.1 | conjugal transfer protein | - |
FGL14_RS03090 | 565836..566099 | - | 264 | WP_003058063.1 | hypothetical protein | - |
FGL14_RS03095 | 566109..566381 | - | 273 | WP_003058046.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | tufA | 497181..631969 | 134788 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13438.41 Da Isoelectric Point: 7.0067
>T288533 WP_003058081.1 NZ_LR594045:c561412-561071 [Streptococcus dysgalactiae subsp. equisimilis]
MAYNVQITKSAERDLDSIYQFYLDEFSEQSALKVIKSLQDAISFLYVSPLGYTDFDSKINRKIYPQGNLRMIPSKQYLIF
YLIREERVDVLRIIHSRTDYLNNLENLFKNLNL
MAYNVQITKSAERDLDSIYQFYLDEFSEQSALKVIKSLQDAISFLYVSPLGYTDFDSKINRKIYPQGNLRMIPSKQYLIF
YLIREERVDVLRIIHSRTDYLNNLENLFKNLNL
Download Length: 342 bp
Antitoxin
Download Length: 96 a.a. Molecular weight: 10868.35 Da Isoelectric Point: 4.4929
>AT288533 WP_138083747.1 NZ_LR594045:c561689-561402 [Streptococcus dysgalactiae subsp. equisimilis]
MNTLARDRQYNFRVNADMLNQAKEILEEKHMSLPDALNLFVEQVVVTKNLPIKTPEQVQAESFLNELISELDEGYQDVLK
GNTKPANEVFAKYGL
MNTLARDRQYNFRVNADMLNQAKEILEEKHMSLPDALNLFVEQVVVTKNLPIKTPEQVQAESFLNELISELDEGYQDVLK
GNTKPANEVFAKYGL
Download Length: 288 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|