Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1199432..1200106 | Replicon | chromosome |
Accession | NZ_LR594040 | ||
Organism | Streptococcus australis strain NCTC5338 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | J4TEA9 |
Locus tag | FGK98_RS05995 | Protein ID | WP_001132280.1 |
Coordinates | 1199432..1199611 (+) | Length | 60 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | FGK98_RS06000 | Protein ID | WP_138100464.1 |
Coordinates | 1199654..1200106 (+) | Length | 151 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FGK98_RS05960 | 1194966..1195298 | + | 333 | WP_138100458.1 | DNA-binding protein | - |
FGK98_RS05965 | 1195291..1195569 | + | 279 | WP_138100459.1 | XRE family transcriptional regulator | - |
FGK98_RS05970 | 1195580..1196359 | + | 780 | WP_138100460.1 | phage replisome organizer N-terminal domain-containing protein | - |
FGK98_RS05975 | 1196375..1197199 | + | 825 | WP_138100461.1 | ATP-binding protein | - |
FGK98_RS05980 | 1197224..1197682 | + | 459 | WP_138100462.1 | hypothetical protein | - |
FGK98_RS05985 | 1197780..1198289 | + | 510 | WP_138101048.1 | hypothetical protein | - |
FGK98_RS05990 | 1198790..1199209 | + | 420 | WP_138100463.1 | DUF1492 domain-containing protein | - |
FGK98_RS05995 | 1199432..1199611 | + | 180 | WP_001132280.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
FGK98_RS06000 | 1199654..1200106 | + | 453 | WP_138100464.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
FGK98_RS06005 | 1200223..1200432 | + | 210 | WP_138100465.1 | hypothetical protein | - |
FGK98_RS06010 | 1200976..1201902 | - | 927 | WP_138100466.1 | aldo/keto reductase | - |
FGK98_RS06020 | 1202260..1204284 | - | 2025 | WP_138100467.1 | glucosaminidase domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1190709..1200432 | 9723 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6642.83 Da Isoelectric Point: 10.7304
>T288527 WP_001132280.1 NZ_LR594040:1199432-1199611 [Streptococcus australis]
MPMTQKEMVKLLTAHGWIKTKGGKGSHVKMEKEGERPITVPHGELNKYTERGIRKQAGL
MPMTQKEMVKLLTAHGWIKTKGGKGSHVKMEKEGERPITVPHGELNKYTERGIRKQAGL
Download Length: 180 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16662.60 Da Isoelectric Point: 3.8817
>AT288527 WP_138100464.1 NZ_LR594040:1199654-1200106 [Streptococcus australis]
MLVTYPALFYYDDTDGANAPYFVTFPDFEHSATQGEDMADAMAMASDWLGINLADYIENGREIPTPTPINALSLANNNPF
RDDEDIELVYDPSKSFVSMVMVDVAEYLGSQEPVKKTLTIPRWADTLGRDLGLNFSQTLTDAIADKKIHA
MLVTYPALFYYDDTDGANAPYFVTFPDFEHSATQGEDMADAMAMASDWLGINLADYIENGREIPTPTPINALSLANNNPF
RDDEDIELVYDPSKSFVSMVMVDVAEYLGSQEPVKKTLTIPRWADTLGRDLGLNFSQTLTDAIADKKIHA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|