Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5681572..5682182 | Replicon | chromosome |
| Accession | NZ_LR594038 | ||
| Organism | Klebsiella grimontii strain NCTC9146 substr. serovar casular | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A9E1GAR7 |
| Locus tag | FGL39_RS27015 | Protein ID | WP_049086919.1 |
| Coordinates | 5681572..5681946 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | FGL39_RS27020 | Protein ID | WP_077253475.1 |
| Coordinates | 5681943..5682182 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FGL39_RS27000 | 5678727..5679629 | + | 903 | WP_004122548.1 | formate dehydrogenase subunit beta | - |
| FGL39_RS27005 | 5679626..5680261 | + | 636 | WP_004132860.1 | formate dehydrogenase cytochrome b556 subunit | - |
| FGL39_RS27010 | 5680605..5681534 | + | 930 | WP_004132861.1 | formate dehydrogenase accessory protein FdhE | - |
| FGL39_RS27015 | 5681572..5681946 | - | 375 | WP_049086919.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| FGL39_RS27020 | 5681943..5682182 | - | 240 | WP_077253475.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| FGL39_RS27025 | 5682388..5683305 | + | 918 | WP_024360706.1 | alpha/beta hydrolase | - |
| FGL39_RS27030 | 5683323..5684264 | - | 942 | WP_004127112.1 | fatty acid biosynthesis protein FabY | - |
| FGL39_RS27035 | 5684309..5684746 | - | 438 | WP_004132870.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
| FGL39_RS27040 | 5684743..5685603 | - | 861 | WP_004127107.1 | virulence factor BrkB family protein | - |
| FGL39_RS27045 | 5685597..5686196 | - | 600 | WP_004132872.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14111.45 Da Isoelectric Point: 8.4571
>T288525 WP_049086919.1 NZ_LR594038:c5681946-5681572 [Klebsiella grimontii]
MIKGPALFDTNILIDLFSGRVEAKQVLEAYPPQNAISLITWMEVMVGAKKYHQEHRTRIALSAFNIIDISQDIAERSVNL
RKEYGMKLPDAIILATAQIHRYELVTRNTKDFFGIPGVITPYHL
MIKGPALFDTNILIDLFSGRVEAKQVLEAYPPQNAISLITWMEVMVGAKKYHQEHRTRIALSAFNIIDISQDIAERSVNL
RKEYGMKLPDAIILATAQIHRYELVTRNTKDFFGIPGVITPYHL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|