Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 5097591..5098271 | Replicon | chromosome |
| Accession | NZ_LR594038 | ||
| Organism | Klebsiella grimontii strain NCTC9146 substr. serovar casular | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | FGL39_RS24245 | Protein ID | WP_138110258.1 |
| Coordinates | 5097591..5097911 (-) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | FGL39_RS24250 | Protein ID | WP_138110260.1 |
| Coordinates | 5097948..5098271 (-) | Length | 108 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FGL39_RS24210 | 5093283..5093855 | - | 573 | WP_138110252.1 | hypothetical protein | - |
| FGL39_RS24215 | 5093883..5094359 | - | 477 | WP_049090447.1 | DUF1643 domain-containing protein | - |
| FGL39_RS24220 | 5094387..5094854 | - | 468 | WP_138110254.1 | hypothetical protein | - |
| FGL39_RS27585 | 5095054..5095206 | - | 153 | WP_171016413.1 | hypothetical protein | - |
| FGL39_RS24230 | 5096020..5096295 | - | 276 | WP_049617298.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| FGL39_RS24235 | 5096299..5096547 | - | 249 | WP_004155191.1 | ribbon-helix-helix domain-containing protein | - |
| FGL39_RS24240 | 5096644..5097477 | - | 834 | WP_138110256.1 | DUF4942 domain-containing protein | - |
| FGL39_RS24245 | 5097591..5097911 | - | 321 | WP_138110258.1 | TA system toxin CbtA family protein | Toxin |
| FGL39_RS24250 | 5097948..5098271 | - | 324 | WP_138110260.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| FGL39_RS24255 | 5098284..5098754 | - | 471 | WP_049617294.1 | DNA repair protein RadC | - |
| FGL39_RS24260 | 5098820..5099641 | - | 822 | WP_138110262.1 | DUF945 domain-containing protein | - |
| FGL39_RS24265 | 5099737..5100204 | - | 468 | WP_171016414.1 | hypothetical protein | - |
| FGL39_RS24270 | 5100249..5100665 | - | 417 | WP_096924353.1 | hypothetical protein | - |
| FGL39_RS24275 | 5100773..5101462 | - | 690 | WP_138110264.1 | WYL domain-containing protein | - |
| FGL39_RS24280 | 5101674..5102549 | - | 876 | WP_138110266.1 | GTPase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 11983.63 Da Isoelectric Point: 5.9538
>T288524 WP_138110258.1 NZ_LR594038:c5097911-5097591 [Klebsiella grimontii]
MHITTVPATVPVSSRLSPVQVWQQLLTYLLEHHYGLTLNDTPFHDDAAIEGHIDAGITLADAVNFLVERYELVRIDRKGF
TWQEQTPFLTATDILRARRATGLINT
MHITTVPATVPVSSRLSPVQVWQQLLTYLLEHHYGLTLNDTPFHDDAAIEGHIDAGITLADAVNFLVERYELVRIDRKGF
TWQEQTPFLTATDILRARRATGLINT
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|