Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 5096020..5096547 Replicon chromosome
Accession NZ_LR594038
Organism Klebsiella grimontii strain NCTC9146 substr. serovar casular

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag FGL39_RS24230 Protein ID WP_049617298.1
Coordinates 5096020..5096295 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID D4HV71
Locus tag FGL39_RS24235 Protein ID WP_004155191.1
Coordinates 5096299..5096547 (-) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FGL39_RS24195 5091289..5091777 - 489 WP_075207248.1 superinfection exclusion B family protein -
FGL39_RS24200 5091781..5092410 - 630 WP_049090450.1 DUF4145 domain-containing protein -
FGL39_RS24205 5092590..5093192 - 603 WP_158414276.1 hypothetical protein -
FGL39_RS24210 5093283..5093855 - 573 WP_138110252.1 hypothetical protein -
FGL39_RS24215 5093883..5094359 - 477 WP_049090447.1 DUF1643 domain-containing protein -
FGL39_RS24220 5094387..5094854 - 468 WP_138110254.1 hypothetical protein -
FGL39_RS27585 5095054..5095206 - 153 WP_171016413.1 hypothetical protein -
FGL39_RS24230 5096020..5096295 - 276 WP_049617298.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
FGL39_RS24235 5096299..5096547 - 249 WP_004155191.1 ribbon-helix-helix domain-containing protein Antitoxin
FGL39_RS24240 5096644..5097477 - 834 WP_138110256.1 DUF4942 domain-containing protein -
FGL39_RS24245 5097591..5097911 - 321 WP_138110258.1 TA system toxin CbtA family protein -
FGL39_RS24250 5097948..5098271 - 324 WP_138110260.1 type IV toxin-antitoxin system YeeU family antitoxin -
FGL39_RS24255 5098284..5098754 - 471 WP_049617294.1 DNA repair protein RadC -
FGL39_RS24260 5098820..5099641 - 822 WP_138110262.1 DUF945 domain-containing protein -
FGL39_RS24265 5099737..5100204 - 468 WP_171016414.1 hypothetical protein -
FGL39_RS24270 5100249..5100665 - 417 WP_096924353.1 hypothetical protein -
FGL39_RS24275 5100773..5101462 - 690 WP_138110264.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 5081625..5097911 16286


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(9-43)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 11122.47 Da        Isoelectric Point: 5.5843

>T288523 WP_049617298.1 NZ_LR594038:c5096295-5096020 [Klebsiella grimontii]
MEIQWTQKAQDDLERIYRFACQYSRQHADNVLERLLIGTSGLAEHPRIGVSQIRYEPREVRKILFDDYDVHYEIQRDTIY
IVDLWHTREDR

Download         Length: 276 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 9121.53 Da        Isoelectric Point: 8.7560

>AT288523 WP_004155191.1 NZ_LR594038:c5096547-5096299 [Klebsiella grimontii]
MRQLAKQTISAQIPAELAAAVENLAIELDRSKSWVIKEALTAMIEERERRHQQILKGLADVDAGRVVSHADVVDFANKLK
KS

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A831A0W7

References