Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4363532..4364151 | Replicon | chromosome |
Accession | NZ_LR594038 | ||
Organism | Klebsiella grimontii strain NCTC9146 substr. serovar casular |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H3N9D8 |
Locus tag | FGL39_RS20770 | Protein ID | WP_004099646.1 |
Coordinates | 4363933..4364151 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | H3N7X7 |
Locus tag | FGL39_RS20765 | Protein ID | WP_004129911.1 |
Coordinates | 4363532..4363906 (+) | Length | 125 a.a. |
Genomic Context
Location: 4358701..4359894 (1194 bp)
Type: Others
Protein ID: WP_138110236.1
Type: Others
Protein ID: WP_138110236.1
Location: 4359917..4363063 (3147 bp)
Type: Others
Protein ID: WP_004848339.1
Type: Others
Protein ID: WP_004848339.1
Location: 4363532..4363906 (375 bp)
Type: Antitoxin
Protein ID: WP_004129911.1
Type: Antitoxin
Protein ID: WP_004129911.1
Location: 4363933..4364151 (219 bp)
Type: Toxin
Protein ID: WP_004099646.1
Type: Toxin
Protein ID: WP_004099646.1
Location: 4364313..4364879 (567 bp)
Type: Others
Protein ID: WP_004136050.1
Type: Others
Protein ID: WP_004136050.1
Location: 4365006..4365476 (471 bp)
Type: Others
Protein ID: WP_004136048.1
Type: Others
Protein ID: WP_004136048.1
Location: 4367006..4367704 (699 bp)
Type: Others
Protein ID: WP_004136044.1
Type: Others
Protein ID: WP_004136044.1
Location: 4365451..4366905 (1455 bp)
Type: Others
Protein ID: WP_049085239.1
Type: Others
Protein ID: WP_049085239.1
Location: 4367701..4367841 (141 bp)
Type: Others
Protein ID: WP_003859006.1
Type: Others
Protein ID: WP_003859006.1
Location: 4367841..4368104 (264 bp)
Type: Others
Protein ID: WP_004129897.1
Type: Others
Protein ID: WP_004129897.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FGL39_RS20755 | 4358701..4359894 | + | 1194 | WP_138110236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
FGL39_RS20760 | 4359917..4363063 | + | 3147 | WP_004848339.1 | multidrug efflux RND transporter permease subunit | - |
FGL39_RS20765 | 4363532..4363906 | + | 375 | WP_004129911.1 | Hha toxicity modulator TomB | Antitoxin |
FGL39_RS20770 | 4363933..4364151 | + | 219 | WP_004099646.1 | hemolysin expression modulator Hha | Toxin |
FGL39_RS20775 | 4364313..4364879 | + | 567 | WP_004136050.1 | maltose O-acetyltransferase | - |
FGL39_RS20780 | 4365006..4365476 | + | 471 | WP_004136048.1 | YlaC family protein | - |
FGL39_RS20785 | 4365451..4366905 | - | 1455 | WP_049085239.1 | PLP-dependent aminotransferase family protein | - |
FGL39_RS20790 | 4367006..4367704 | + | 699 | WP_004136044.1 | GNAT family N-acetyltransferase | - |
FGL39_RS20795 | 4367701..4367841 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
FGL39_RS20800 | 4367841..4368104 | - | 264 | WP_004129897.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8640.05 Da Isoelectric Point: 8.9008
>T288521 WP_004099646.1 NZ_LR594038:4363933-4364151 [Klebsiella grimontii]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14350.09 Da Isoelectric Point: 4.8989
>AT288521 WP_004129911.1 NZ_LR594038:4363532-4363906 [Klebsiella grimontii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3H713 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3HD25 |