Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ypjF-yeeU/CbtA-CbeA |
| Location | 896697..897397 | Replicon | chromosome |
| Accession | NZ_LR594038 | ||
| Organism | Klebsiella grimontii strain NCTC9146 substr. serovar casular | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | A0A7H4NX47 |
| Locus tag | FGL39_RS04385 | Protein ID | WP_001546951.1 |
| Coordinates | 897074..897397 (+) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A7H4NX46 |
| Locus tag | FGL39_RS04380 | Protein ID | WP_045333559.1 |
| Coordinates | 896697..897053 (+) | Length | 119 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FGL39_RS04345 | 892740..893462 | + | 723 | WP_138110053.1 | WYL domain-containing protein | - |
| FGL39_RS04350 | 893492..893944 | + | 453 | WP_138110054.1 | hypothetical protein | - |
| FGL39_RS04355 | 894016..894489 | + | 474 | WP_138110055.1 | hypothetical protein | - |
| FGL39_RS04360 | 894609..895430 | + | 822 | WP_064360222.1 | DUF945 domain-containing protein | - |
| FGL39_RS04365 | 895461..895901 | + | 441 | WP_138110056.1 | antirestriction protein | - |
| FGL39_RS04370 | 895914..896453 | + | 540 | WP_064360220.1 | DNA repair protein RadC | - |
| FGL39_RS04375 | 896450..896671 | + | 222 | WP_138110057.1 | DUF987 domain-containing protein | - |
| FGL39_RS04380 | 896697..897053 | + | 357 | WP_045333559.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| FGL39_RS04385 | 897074..897397 | + | 324 | WP_001546951.1 | TA system toxin CbtA family protein | Toxin |
| FGL39_RS04390 | 897765..898115 | + | 351 | WP_004134443.1 | transcriptional regulator | - |
| FGL39_RS04395 | 898168..899460 | + | 1293 | WP_004134447.1 | arsenic transporter | - |
| FGL39_RS04400 | 899470..899895 | + | 426 | WP_004134449.1 | glutaredoxin-dependent arsenate reductase | - |
| FGL39_RS27610 | 900088..900159 | + | 72 | Protein_860 | adenylyl-sulfate kinase | - |
| FGL39_RS04410 | 900288..901937 | - | 1650 | WP_024358595.1 | OFA family MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 883143..897397 | 14254 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12496.55 Da Isoelectric Point: 7.1331
>T288515 WP_001546951.1 NZ_LR594038:897074-897397 [Klebsiella grimontii]
MKFLPTTNMRAAKPCLSPVTIWQMLLSRLLEQHYGLTLNDTPFCDETVIQEHIDAGITLANAINFLVEKYELVRIDRRGF
SWQEQTPYLTIIDIMRARRDLGLMNRN
MKFLPTTNMRAAKPCLSPVTIWQMLLSRLLEQHYGLTLNDTPFCDETVIQEHIDAGITLANAINFLVEKYELVRIDRRGF
SWQEQTPYLTIIDIMRARRDLGLMNRN
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7H4NX47 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7H4NX46 |