Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ypjF-yeeU/CbtA-CbeA
Location 896697..897397 Replicon chromosome
Accession NZ_LR594038
Organism Klebsiella grimontii strain NCTC9146 substr. serovar casular

Toxin (Protein)


Gene name ypjF Uniprot ID A0A7H4NX47
Locus tag FGL39_RS04385 Protein ID WP_001546951.1
Coordinates 897074..897397 (+) Length 108 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A7H4NX46
Locus tag FGL39_RS04380 Protein ID WP_045333559.1
Coordinates 896697..897053 (+) Length 119 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FGL39_RS04345 892740..893462 + 723 WP_138110053.1 WYL domain-containing protein -
FGL39_RS04350 893492..893944 + 453 WP_138110054.1 hypothetical protein -
FGL39_RS04355 894016..894489 + 474 WP_138110055.1 hypothetical protein -
FGL39_RS04360 894609..895430 + 822 WP_064360222.1 DUF945 domain-containing protein -
FGL39_RS04365 895461..895901 + 441 WP_138110056.1 antirestriction protein -
FGL39_RS04370 895914..896453 + 540 WP_064360220.1 DNA repair protein RadC -
FGL39_RS04375 896450..896671 + 222 WP_138110057.1 DUF987 domain-containing protein -
FGL39_RS04380 896697..897053 + 357 WP_045333559.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
FGL39_RS04385 897074..897397 + 324 WP_001546951.1 TA system toxin CbtA family protein Toxin
FGL39_RS04390 897765..898115 + 351 WP_004134443.1 transcriptional regulator -
FGL39_RS04395 898168..899460 + 1293 WP_004134447.1 arsenic transporter -
FGL39_RS04400 899470..899895 + 426 WP_004134449.1 glutaredoxin-dependent arsenate reductase -
FGL39_RS27610 900088..900159 + 72 Protein_860 adenylyl-sulfate kinase -
FGL39_RS04410 900288..901937 - 1650 WP_024358595.1 OFA family MFS transporter -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 883143..897397 14254


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-107)

Antitoxin

Antitoxin CbeA

(17-117)


Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 12496.55 Da        Isoelectric Point: 7.1331

>T288515 WP_001546951.1 NZ_LR594038:897074-897397 [Klebsiella grimontii]
MKFLPTTNMRAAKPCLSPVTIWQMLLSRLLEQHYGLTLNDTPFCDETVIQEHIDAGITLANAINFLVEKYELVRIDRRGF
SWQEQTPYLTIIDIMRARRDLGLMNRN

Download         Length: 324 bp

Antitoxin


Download         Length: 119 a.a.        Molecular weight: 13116.78 Da        Isoelectric Point: 5.4295

>AT288515 WP_045333559.1 NZ_LR594038:896697-897053 [Klebsiella grimontii]
MNYHSESGAIPENPPCQHWGLKSTITPCFGARLVQEGDRLHFLADRAGFNGAFCDDDALYLDQAFPLILKQLELTLTSGE
LSPRHQHCVTLYHNGLTCEADTLGSCGYVYIAIYPTQR

Download         Length: 357 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7H4NX47

Antitoxin

Source ID Structure
AlphaFold DB A0A7H4NX46

References