Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 832299..832956 | Replicon | chromosome |
| Accession | NZ_LR594038 | ||
| Organism | Klebsiella grimontii strain NCTC9146 substr. serovar casular | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A285B9I7 |
| Locus tag | FGL39_RS04060 | Protein ID | WP_004134421.1 |
| Coordinates | 832546..832956 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A285B945 |
| Locus tag | FGL39_RS04055 | Protein ID | WP_004105561.1 |
| Coordinates | 832299..832565 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FGL39_RS04030 | 827478..828911 | - | 1434 | WP_004133593.1 | 6-phospho-beta-glucosidase | - |
| FGL39_RS04035 | 829033..829761 | - | 729 | WP_024358621.1 | MurR/RpiR family transcriptional regulator | - |
| FGL39_RS04040 | 829812..830123 | + | 312 | WP_004133599.1 | N(4)-acetylcytidine aminohydrolase | - |
| FGL39_RS04045 | 830286..830945 | + | 660 | WP_004124978.1 | hemolysin III family protein | - |
| FGL39_RS04050 | 831072..832055 | - | 984 | WP_049087337.1 | tRNA-modifying protein YgfZ | - |
| FGL39_RS04055 | 832299..832565 | + | 267 | WP_004105561.1 | FAD assembly factor SdhE | Antitoxin |
| FGL39_RS04060 | 832546..832956 | + | 411 | WP_004134421.1 | protein YgfX | Toxin |
| FGL39_RS04065 | 832965..833486 | - | 522 | WP_004134423.1 | flavodoxin FldB | - |
| FGL39_RS04070 | 833608..834504 | + | 897 | WP_004124942.1 | site-specific tyrosine recombinase XerD | - |
| FGL39_RS04075 | 834527..835240 | + | 714 | WP_004134425.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| FGL39_RS04080 | 835246..836979 | + | 1734 | WP_004134426.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16075.86 Da Isoelectric Point: 10.9455
>T288514 WP_004134421.1 NZ_LR594038:832546-832956 [Klebsiella grimontii]
VVLWQSDLRISWRAQWFSLLMHGVVAALVLVLPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIVGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLQKPTQE
VVLWQSDLRISWRAQWFSLLMHGVVAALVLVLPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIVGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLQKPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A285B9I7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A285B945 |