Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
Location | 1491931..1492482 | Replicon | chromosome |
Accession | NZ_LR594037 | ||
Organism | Streptococcus anginosus strain NCTC11064 |
Toxin (Protein)
Gene name | relE | Uniprot ID | D0RWL8 |
Locus tag | FGK97_RS07460 | Protein ID | WP_008809670.1 |
Coordinates | 1492204..1492482 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A5N1G2T1 |
Locus tag | FGK97_RS07455 | Protein ID | WP_059221290.1 |
Coordinates | 1491931..1492203 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FGK97_RS07435 | 1487306..1488061 | - | 756 | WP_062200670.1 | NTPase | - |
FGK97_RS07440 | 1488763..1489946 | + | 1184 | Protein_1411 | transposase | - |
FGK97_RS07445 | 1490033..1490884 | - | 852 | WP_171004452.1 | ImmA/IrrE family metallo-endopeptidase | - |
FGK97_RS07450 | 1490891..1491253 | - | 363 | WP_002270986.1 | helix-turn-helix domain-containing protein | - |
FGK97_RS07455 | 1491931..1492203 | + | 273 | WP_059221290.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
FGK97_RS07460 | 1492204..1492482 | + | 279 | WP_008809670.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
FGK97_RS07465 | 1492611..1492847 | + | 237 | WP_138099486.1 | hypothetical protein | - |
FGK97_RS07475 | 1493186..1493500 | + | 315 | WP_138099488.1 | hypothetical protein | - |
FGK97_RS07480 | 1493523..1493933 | + | 411 | WP_138099489.1 | DUF961 family protein | - |
FGK97_RS07485 | 1493940..1495598 | + | 1659 | WP_138099490.1 | cell division protein FtsK | - |
FGK97_RS07490 | 1496085..1496453 | - | 369 | WP_003042548.1 | EXLDI protein | - |
FGK97_RS07495 | 1496480..1497097 | - | 618 | WP_138099491.1 | DNA alkylation repair protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 1446408..1619791 | 173383 | |
- | flank | IS/Tn | - | - | 1489566..1489946 | 380 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10862.69 Da Isoelectric Point: 8.0383
>T288513 WP_008809670.1 NZ_LR594037:1492204-1492482 [Streptococcus anginosus]
MYQVKFTSAFKKSYKRIKKRGLDIALLDEVIEKLRLGQTLEEKYRDHELKGNFVGFRECHIKPDWLLIYLIEDDILTLTL
ADTGSHADLFKM
MYQVKFTSAFKKSYKRIKKRGLDIALLDEVIEKLRLGQTLEEKYRDHELKGNFVGFRECHIKPDWLLIYLIEDDILTLTL
ADTGSHADLFKM
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | D0RWL8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5N1G2T1 |