Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/- |
Location | 1313922..1314537 | Replicon | chromosome |
Accession | NZ_LR594035 | ||
Organism | Streptococcus pseudoporcinus strain NCTC5385 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | FGL04_RS06840 | Protein ID | WP_138068665.1 |
Coordinates | 1313922..1314260 (-) | Length | 113 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | FGL04_RS06845 | Protein ID | WP_138068666.1 |
Coordinates | 1314250..1314537 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FGL04_RS06810 | 1308970..1309587 | - | 618 | Protein_1317 | hypothetical protein | - |
FGL04_RS06815 | 1309775..1310880 | + | 1106 | WP_138068165.1 | IS3 family transposase | - |
FGL04_RS06820 | 1310922..1311293 | - | 372 | Protein_1319 | ABC transporter ATP-binding protein | - |
FGL04_RS06825 | 1311410..1312016 | - | 607 | Protein_1320 | TetR/AcrR family transcriptional regulator | - |
FGL04_RS06830 | 1312468..1312821 | + | 354 | WP_138068664.1 | plasmid mobilization relaxosome protein MobC | - |
FGL04_RS06835 | 1312804..1313361 | - | 558 | WP_138069164.1 | replication initiation factor domain-containing protein | - |
FGL04_RS06840 | 1313922..1314260 | - | 339 | WP_138068665.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
FGL04_RS06845 | 1314250..1314537 | - | 288 | WP_138068666.1 | XRE family transcriptional regulator | Antitoxin |
FGL04_RS06855 | 1316033..1316407 | + | 375 | Protein_1326 | DDE-type integrase/transposase/recombinase | - |
FGL04_RS06860 | 1316443..1317423 | - | 981 | Protein_1327 | glucan-binding protein | - |
FGL04_RS06870 | 1317701..1318291 | + | 591 | WP_138068667.1 | type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein | - |
FGL04_RS06875 | 1318288..1319133 | + | 846 | WP_138068668.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | IScluster/Tn | - | - | 1306011..1316407 | 10396 | |
- | inside | Prophage | - | - | 1272672..1333433 | 60761 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 13179.40 Da Isoelectric Point: 9.8162
>T288506 WP_138068665.1 NZ_LR594035:c1314260-1313922 [Streptococcus pseudoporcinus]
MESKIYEIRYSSQVAQTLLEIRDYIFEISKSENIADKNIEKIIKGIEVLKLFPEAGFNADKKFGKKIDEKRSIRGITLKK
NYIALYDIDDKNFVVNIRYLLATKSDYMKLFK
MESKIYEIRYSSQVAQTLLEIRDYIFEISKSENIADKNIEKIIKGIEVLKLFPEAGFNADKKFGKKIDEKRSIRGITLKK
NYIALYDIDDKNFVVNIRYLLATKSDYMKLFK
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|