Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 981456..982068 | Replicon | chromosome |
Accession | NZ_LR590625 | ||
Organism | Streptococcus canis strain B700072 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A4V0C1F2 |
Locus tag | FGK95_RS05045 | Protein ID | WP_003048651.1 |
Coordinates | 981733..982068 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1Q8EDD0 |
Locus tag | FGK95_RS05040 | Protein ID | WP_017648215.1 |
Coordinates | 981456..981743 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FGK95_RS05020 | 977009..978214 | + | 1206 | WP_003048662.1 | 30S ribosomal protein S1 | - |
FGK95_RS05025 | 978336..979571 | + | 1236 | WP_138114176.1 | D-alanyl-D-alanine carboxypeptidase PBP3 | - |
FGK95_RS05030 | 979683..980651 | - | 969 | WP_093999033.1 | polysaccharide deacetylase family protein | - |
FGK95_RS05035 | 980837..981279 | + | 443 | Protein_913 | hypothetical protein | - |
FGK95_RS05040 | 981456..981743 | + | 288 | WP_017648215.1 | hypothetical protein | Antitoxin |
FGK95_RS05045 | 981733..982068 | + | 336 | WP_003048651.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
FGK95_RS05050 | 982691..983546 | + | 856 | Protein_916 | homoserine kinase | - |
FGK95_RS05055 | 983637..984905 | + | 1269 | WP_093999035.1 | bifunctional folylpolyglutamate synthase/dihydrofolate synthase | - |
FGK95_RS05060 | 984937..985503 | + | 567 | WP_093999036.1 | GTP cyclohydrolase I FolE | - |
FGK95_RS05065 | 985512..986312 | + | 801 | WP_093999037.1 | dihydropteroate synthase | - |
FGK95_RS05070 | 986319..986678 | + | 360 | WP_093999038.1 | dihydroneopterin aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13215.04 Da Isoelectric Point: 6.2385
>T288504 WP_003048651.1 NZ_LR590625:981733-982068 [Streptococcus canis]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQHKMEQIISDIEKLKVFPEVGFDADEKYGSKISKYHSTRGYTLSKD
YIVLYHIEEEENRVVIDYLLPARSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQHKMEQIISDIEKLKVFPEVGFDADEKYGSKISKYHSTRGYTLSKD
YIVLYHIEEEENRVVIDYLLPARSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4V0C1F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8EDD0 |