Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 126225..126902 | Replicon | chromosome |
Accession | NZ_LR590625 | ||
Organism | Streptococcus canis strain B700072 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | V6Z2K9 |
Locus tag | FGK95_RS00800 | Protein ID | WP_015647112.1 |
Coordinates | 126225..126407 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | FGK95_RS00805 | Protein ID | WP_093998740.1 |
Coordinates | 126447..126902 (+) | Length | 152 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FGK95_RS00765 | 122249..123076 | - | 828 | WP_093999408.1 | EbhA | - |
FGK95_RS00770 | 123502..124161 | - | 660 | WP_093999409.1 | helix-turn-helix transcriptional regulator | - |
FGK95_RS00775 | 124324..124523 | + | 200 | Protein_103 | helix-turn-helix transcriptional regulator | - |
FGK95_RS00780 | 124540..125175 | + | 636 | WP_138114008.1 | Bro-N domain-containing protein | - |
FGK95_RS00785 | 125189..125434 | + | 246 | WP_164403324.1 | phage antirepressor protein | - |
FGK95_RS00790 | 125689..126021 | + | 333 | WP_050319961.1 | hypothetical protein | - |
FGK95_RS00800 | 126225..126407 | + | 183 | WP_015647112.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
FGK95_RS00805 | 126447..126902 | + | 456 | WP_093998740.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
FGK95_RS00810 | 127268..128527 | - | 1260 | WP_138114011.1 | tyrosine--tRNA ligase | - |
FGK95_RS00815 | 128634..130934 | + | 2301 | WP_164403322.1 | penicillin-binding protein PBP1B | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6630.84 Da Isoelectric Point: 10.8207
>T288502 WP_015647112.1 NZ_LR590625:126225-126407 [Streptococcus canis]
MPMTQKEMVKLLTANGWTKTKGGKGSHVKLEKAGERPITIPHGEINKYTERGIKKQAGLL
MPMTQKEMVKLLTANGWTKTKGGKGSHVKLEKAGERPITIPHGEINKYTERGIKKQAGLL
Download Length: 183 bp
Antitoxin
Download Length: 152 a.a. Molecular weight: 17065.12 Da Isoelectric Point: 4.0258
>AT288502 WP_093998740.1 NZ_LR590625:126447-126902 [Streptococcus canis]
MLVTYPALFYYDDTQGETVAPYFVTFPDFEYSATQGEDMADAMAMASEWLGINLADYIENGRDIPKPSDINSLSLVDNNP
FREDKDFRLTYDPNKSFISLVMVDVSEYLGSQEPIKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
MLVTYPALFYYDDTQGETVAPYFVTFPDFEYSATQGEDMADAMAMASEWLGINLADYIENGRDIPKPSDINSLSLVDNNP
FREDKDFRLTYDPNKSFISLVMVDVSEYLGSQEPIKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
Download Length: 456 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|