Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 1582494..1583106 | Replicon | chromosome |
Accession | NZ_LR590483 | ||
Organism | Streptococcus pyogenes strain NCTC8318 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q5X9X8 |
Locus tag | FGK91_RS08135 | Protein ID | WP_011018227.1 |
Coordinates | 1582771..1583106 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q5X9X9 |
Locus tag | FGK91_RS08130 | Protein ID | WP_002988079.1 |
Coordinates | 1582494..1582781 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FGK91_RS08100 | 1577672..1578655 | - | 984 | WP_011285168.1 | tagatose-bisphosphate aldolase | - |
FGK91_RS08105 | 1578659..1579588 | - | 930 | WP_146710371.1 | tagatose-6-phosphate kinase | - |
FGK91_RS08110 | 1579636..1580151 | - | 516 | WP_002991700.1 | galactose-6-phosphate isomerase subunit LacB | - |
FGK91_RS08115 | 1580186..1580614 | - | 429 | WP_146710372.1 | galactose-6-phosphate isomerase subunit LacA | - |
FGK91_RS08120 | 1581060..1581833 | + | 774 | WP_011285171.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
FGK91_RS08130 | 1582494..1582781 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
FGK91_RS08135 | 1582771..1583106 | + | 336 | WP_011018227.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
FGK91_RS09355 | 1583258..1583728 | + | 471 | Protein_1500 | integrase | - |
FGK91_RS09360 | 1584061..1584210 | + | 150 | WP_011285175.1 | integrase | - |
FGK91_RS08150 | 1584330..1584722 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
FGK91_RS08155 | 1584743..1585189 | - | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
FGK91_RS08160 | 1585407..1585613 | - | 207 | WP_023078893.1 | helix-turn-helix transcriptional regulator | - |
FGK91_RS08165 | 1585610..1586308 | - | 699 | WP_023078900.1 | hypothetical protein | - |
FGK91_RS08170 | 1586444..1587304 | - | 861 | WP_011529009.1 | DegV family protein | - |
FGK91_RS08175 | 1587401..1587919 | - | 519 | WP_011055010.1 | NYN domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13171.97 Da Isoelectric Point: 5.2144
>T288501 WP_011018227.1 NZ_LR590483:1582771-1583106 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKIIHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKIIHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7Z2QKE7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4U7GX94 |