Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
Location | 5590908..5591494 | Replicon | chromosome |
Accession | NZ_LR590482 | ||
Organism | Pseudomonas synxantha strain NCTC10696 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | FGL41_RS25915 | Protein ID | WP_014717392.1 |
Coordinates | 5590908..5591216 (+) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | FGL41_RS25920 | Protein ID | WP_014717391.1 |
Coordinates | 5591213..5591494 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FGL41_RS25885 | 5586744..5587298 | + | 555 | WP_057021798.1 | hypothetical protein | - |
FGL41_RS25890 | 5587369..5587989 | + | 621 | WP_057021760.1 | HEPN domain-containing protein | - |
FGL41_RS25895 | 5587991..5589061 | + | 1071 | WP_057021761.1 | hypothetical protein | - |
FGL41_RS25900 | 5589129..5589563 | + | 435 | WP_057021762.1 | hypothetical protein | - |
FGL41_RS25905 | 5589574..5590095 | + | 522 | WP_057021763.1 | hypothetical protein | - |
FGL41_RS25910 | 5590095..5590850 | + | 756 | WP_057021764.1 | hypothetical protein | - |
FGL41_RS25915 | 5590908..5591216 | + | 309 | WP_014717392.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
FGL41_RS25920 | 5591213..5591494 | + | 282 | WP_014717391.1 | putative addiction module antidote protein | Antitoxin |
FGL41_RS25925 | 5591582..5592412 | - | 831 | WP_138233660.1 | hypothetical protein | - |
FGL41_RS25930 | 5592427..5592747 | - | 321 | WP_083348205.1 | hypothetical protein | - |
FGL41_RS25935 | 5592824..5593555 | - | 732 | WP_057021799.1 | hypothetical protein | - |
FGL41_RS25940 | 5593868..5594560 | - | 693 | WP_057021766.1 | SOS response-associated peptidase family protein | - |
FGL41_RS25945 | 5594675..5595790 | - | 1116 | WP_138233661.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 5528477..5734273 | 205796 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11532.13 Da Isoelectric Point: 9.0774
>T288500 WP_014717392.1 NZ_LR590482:5590908-5591216 [Pseudomonas synxantha]
MNTLITTTEFNQWLKGLKDDRARARIVSRMVSAQEGNFGDCEPVGDGISEMRIFVGPGYRVYYTRRGEVVYLLLCGGDKS
SQKRDIRAAKAILNEIDRGERT
MNTLITTTEFNQWLKGLKDDRARARIVSRMVSAQEGNFGDCEPVGDGISEMRIFVGPGYRVYYTRRGEVVYLLLCGGDKS
SQKRDIRAAKAILNEIDRGERT
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|