Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
Location | 5269947..5270488 | Replicon | chromosome |
Accession | NZ_LR590482 | ||
Organism | Pseudomonas synxantha strain NCTC10696 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | FGL41_RS24390 | Protein ID | WP_082636603.1 |
Coordinates | 5269947..5270222 (-) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A921NKV7 |
Locus tag | FGL41_RS24395 | Protein ID | WP_032893597.1 |
Coordinates | 5270222..5270488 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FGL41_RS24370 | 5265536..5266429 | + | 894 | WP_057021588.1 | glycine betaine ABC transporter substrate-binding protein | - |
FGL41_RS24375 | 5266442..5267095 | + | 654 | WP_034118069.1 | ABC transporter permease | - |
FGL41_RS24380 | 5267092..5268249 | + | 1158 | WP_043048518.1 | ABC transporter ATP-binding protein | - |
FGL41_RS24385 | 5268720..5269883 | + | 1164 | WP_003188470.1 | type III PLP-dependent enzyme | - |
FGL41_RS24390 | 5269947..5270222 | - | 276 | WP_082636603.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
FGL41_RS24395 | 5270222..5270488 | - | 267 | WP_032893597.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
FGL41_RS24400 | 5270632..5271390 | - | 759 | WP_057021589.1 | sel1 repeat family protein | - |
FGL41_RS24405 | 5271392..5272072 | - | 681 | WP_057021590.1 | Fe2+-dependent dioxygenase | - |
FGL41_RS24410 | 5272278..5274563 | + | 2286 | WP_057021591.1 | TonB-dependent siderophore receptor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10785.36 Da Isoelectric Point: 8.5145
>T288499 WP_082636603.1 NZ_LR590482:c5270222-5269947 [Pseudomonas synxantha]
MELRWTSKALSDLARLYDFLSVVNREAAARIVQSLSQAPDALLGNPRIGERIEEFSPRDVRRLLVGHYEMRYEIQQSTLY
ILRLWHVREDR
MELRWTSKALSDLARLYDFLSVVNREAAARIVQSLSQAPDALLGNPRIGERIEEFSPRDVRRLLVGHYEMRYEIQQSTLY
ILRLWHVREDR
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|