Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RHH
Location 4609697..4610210 Replicon chromosome
Accession NZ_LR590482
Organism Pseudomonas synxantha strain NCTC10696

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag FGL41_RS21380 Protein ID WP_082636613.1
Coordinates 4609926..4610210 (+) Length 95 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag FGL41_RS21375 Protein ID WP_057022003.1
Coordinates 4609697..4609936 (+) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FGL41_RS21330 4604792..4604974 + 183 WP_082636614.1 type II toxin-antitoxin system HicA family toxin -
FGL41_RS21335 4604997..4605407 + 411 WP_057022010.1 type II toxin-antitoxin system HicB family antitoxin -
FGL41_RS21340 4605490..4605801 + 312 WP_057022009.1 hypothetical protein -
FGL41_RS21345 4605901..4606401 + 501 WP_057022008.1 methylated-DNA--[protein]-cysteine S-methyltransferase -
FGL41_RS21350 4606402..4607184 - 783 WP_057022007.1 GNAT family N-acetyltransferase -
FGL41_RS21355 4607363..4607788 + 426 WP_057022006.1 low affinity iron permease family protein -
FGL41_RS21360 4607844..4608371 - 528 WP_005785958.1 DUF4142 domain-containing protein -
FGL41_RS21365 4608492..4609133 - 642 WP_057022005.1 LysE family translocator -
FGL41_RS21370 4609181..4609597 - 417 WP_057022004.1 fosfomycin resistance glutathione transferase -
FGL41_RS21375 4609697..4609936 + 240 WP_057022003.1 ribbon-helix-helix protein, CopG family Antitoxin
FGL41_RS21380 4609926..4610210 + 285 WP_082636613.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
FGL41_RS21385 4610218..4611135 - 918 WP_057022002.1 LysR family transcriptional regulator -
FGL41_RS21390 4611204..4611692 + 489 WP_057022001.1 DMT family transporter -
FGL41_RS21395 4611716..4612390 - 675 WP_057022000.1 NAD(P)H-binding protein -
FGL41_RS21400 4612481..4613629 - 1149 WP_057021999.1 L-threonine dehydrogenase -
FGL41_RS21405 4613753..4614769 + 1017 WP_057021998.1 DUF4917 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(5-41)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 11121.86 Da        Isoelectric Point: 10.4171

>T288498 WP_082636613.1 NZ_LR590482:4609926-4610210 [Pseudomonas synxantha]
MQIEWLRTALRNLDDEAAYIAEENPKAAHEFVQAILSGLEHVARFPAMGKEGRVPGTREWVVPRWPYIVPYRIREGRLQV
MRIFHTRRQPPKSW

Download         Length: 285 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8651.81 Da        Isoelectric Point: 4.5843

>AT288498 WP_057022003.1 NZ_LR590482:4609697-4609936 [Pseudomonas synxantha]
MSVMSLRIPEDVAETLTNLAKATGRSKSFLAVDALREYLAREAWQIEEIQKALKEADAGEFATVAEVNAVAAKWRANAD

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References