Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 4604792..4605407 Replicon chromosome
Accession NZ_LR590482
Organism Pseudomonas synxantha strain NCTC10696

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag FGL41_RS21330 Protein ID WP_082636614.1
Coordinates 4604792..4604974 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A0R2Z981
Locus tag FGL41_RS21335 Protein ID WP_057022010.1
Coordinates 4604997..4605407 (+) Length 137 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FGL41_RS21300 4600060..4600272 + 213 WP_057022016.1 cysteine-rich CWC family protein -
FGL41_RS21305 4600262..4600954 + 693 WP_057022015.1 pseudouridine synthase -
FGL41_RS21310 4601256..4602140 + 885 WP_057022014.1 alpha/beta hydrolase -
FGL41_RS21320 4602461..4603636 - 1176 WP_057022013.1 MFS transporter -
FGL41_RS21325 4603732..4604625 + 894 WP_057022012.1 LysR family transcriptional regulator -
FGL41_RS21330 4604792..4604974 + 183 WP_082636614.1 type II toxin-antitoxin system HicA family toxin Toxin
FGL41_RS21335 4604997..4605407 + 411 WP_057022010.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
FGL41_RS21340 4605490..4605801 + 312 WP_057022009.1 hypothetical protein -
FGL41_RS21345 4605901..4606401 + 501 WP_057022008.1 methylated-DNA--[protein]-cysteine S-methyltransferase -
FGL41_RS21350 4606402..4607184 - 783 WP_057022007.1 GNAT family N-acetyltransferase -
FGL41_RS21355 4607363..4607788 + 426 WP_057022006.1 low affinity iron permease family protein -
FGL41_RS21360 4607844..4608371 - 528 WP_005785958.1 DUF4142 domain-containing protein -
FGL41_RS21365 4608492..4609133 - 642 WP_057022005.1 LysE family translocator -
FGL41_RS21370 4609181..4609597 - 417 WP_057022004.1 fosfomycin resistance glutathione transferase -
FGL41_RS21375 4609697..4609936 + 240 WP_057022003.1 ribbon-helix-helix protein, CopG family -
FGL41_RS21380 4609926..4610210 + 285 WP_082636613.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(6-57)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-128)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6832.02 Da        Isoelectric Point: 10.8600

>T288497 WP_082636614.1 NZ_LR590482:4604792-4604974 [Pseudomonas synxantha]
VDSRYLIGHIVADGWYLVRIRGSHHHFKHPTKPGLVTIPHPKKDLLDKTAKSILRQALLS

Download         Length: 183 bp

Antitoxin


Download         Length: 137 a.a.        Molecular weight: 14782.73 Da        Isoelectric Point: 4.4720

>AT288497 WP_057022010.1 NZ_LR590482:4604997-4605407 [Pseudomonas synxantha]
MLYPIAISTGDKDHAWGVEVPDIPGCYSAGDDLDDAMAMAREAIEGHFEILAEDGAPIPSAQKVTLHAANPQYAGCTWAV
VDIDVTKYLGKAQKLNITLPGYLLNRIDEYVLNHPEEKSRSGFLASAALKVLQQDR

Download         Length: 411 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0R2Z981

References