Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-RelB
Location 4563220..4563742 Replicon chromosome
Accession NZ_LR590482
Organism Pseudomonas synxantha strain NCTC10696

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag FGL41_RS21130 Protein ID WP_057022032.1
Coordinates 4563449..4563742 (+) Length 98 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0W0N4Z1
Locus tag FGL41_RS21125 Protein ID WP_014717442.1
Coordinates 4563220..4563459 (+) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FGL41_RS21095 4559120..4560061 + 942 WP_057022037.1 LysR family transcriptional regulator -
FGL41_RS21100 4560167..4560481 + 315 WP_057022036.1 type II toxin-antitoxin system RelE/ParE family toxin -
FGL41_RS21105 4560484..4560771 + 288 WP_057022035.1 helix-turn-helix domain-containing protein -
FGL41_RS21110 4561011..4562237 + 1227 WP_057022034.1 MFS transporter -
FGL41_RS21115 4562312..4562566 - 255 WP_057022033.1 hypothetical protein -
FGL41_RS21125 4563220..4563459 + 240 WP_014717442.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
FGL41_RS21130 4563449..4563742 + 294 WP_057022032.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
FGL41_RS21140 4564011..4564724 - 714 WP_057022031.1 phosphoribosylaminoimidazolesuccinocarboxamide synthase -
FGL41_RS21145 4564752..4565510 - 759 WP_056847351.1 MBL fold metallo-hydrolase -
FGL41_RS21150 4565515..4566630 - 1116 WP_057022030.1 outer membrane protein assembly factor BamC -
FGL41_RS21155 4566648..4567526 - 879 WP_046071422.1 4-hydroxy-tetrahydrodipicolinate synthase -
FGL41_RS21160 4567788..4568348 + 561 WP_003189463.1 glycine cleavage system protein R -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-84)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-64)


Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 11585.38 Da        Isoelectric Point: 10.0977

>T288496 WP_057022032.1 NZ_LR590482:4563449-4563742 [Pseudomonas synxantha]
MTYSLDFDARALKEWQKLGDTLRQQLKKKLMEILNNPRIEANRLHGLPDCYKIKLRSSGYRLVYQVIDQEVTVFVVAIDK
RERDQAYRKASERLDQR

Download         Length: 294 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8997.40 Da        Isoelectric Point: 4.6017

>AT288496 WP_014717442.1 NZ_LR590482:4563220-4563459 [Pseudomonas synxantha]
MASINIRIDDDLKARAYLELEKLGVTPSELIRQALQYVAERGQLPFKPVLMTEEDEALMATVRERLASPQRVRVSLDDL

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0W0N4Z1

References