Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relB-parE/RHH(antitoxin) |
| Location | 3478722..3479275 | Replicon | chromosome |
| Accession | NZ_LR590482 | ||
| Organism | Pseudomonas synxantha strain NCTC10696 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | FGL41_RS16120 | Protein ID | WP_057022653.1 |
| Coordinates | 3478722..3479015 (-) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | FGL41_RS16125 | Protein ID | WP_057022654.1 |
| Coordinates | 3479003..3479275 (-) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FGL41_RS16095 | 3474163..3474981 | + | 819 | WP_057022648.1 | alpha/beta hydrolase | - |
| FGL41_RS16100 | 3475036..3475422 | - | 387 | WP_057022649.1 | DoxX family protein | - |
| FGL41_RS16105 | 3475503..3476378 | - | 876 | WP_057022650.1 | LysR family transcriptional regulator | - |
| FGL41_RS16110 | 3476490..3477722 | + | 1233 | WP_057022651.1 | YbfB/YjiJ family MFS transporter | - |
| FGL41_RS16115 | 3477719..3478717 | + | 999 | WP_057022652.1 | NAD(P)H-quinone oxidoreductase | - |
| FGL41_RS16120 | 3478722..3479015 | - | 294 | WP_057022653.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| FGL41_RS16125 | 3479003..3479275 | - | 273 | WP_057022654.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| FGL41_RS16130 | 3479379..3480506 | - | 1128 | WP_057022655.1 | alkene reductase | - |
| FGL41_RS16135 | 3480585..3481262 | - | 678 | WP_057022656.1 | type 1 glutamine amidotransferase domain-containing protein | - |
| FGL41_RS16140 | 3481259..3481888 | - | 630 | WP_057022657.1 | TetR/AcrR family transcriptional regulator | - |
| FGL41_RS16145 | 3482061..3482999 | + | 939 | WP_057022658.1 | GlxA family transcriptional regulator | - |
| FGL41_RS16155 | 3483539..3484045 | - | 507 | WP_172833441.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10844.48 Da Isoelectric Point: 6.9784
>T288494 WP_057022653.1 NZ_LR590482:c3479015-3478722 [Pseudomonas synxantha]
VPRLIITATALAGLERCRQLLTEKDPQVARRAAQTINSQLLRLESDPNIGRPYDELPELRELVIAFGDAGYVALYRVIPS
ESAVLVLAFRHQREAGY
VPRLIITATALAGLERCRQLLTEKDPQVARRAAQTINSQLLRLESDPNIGRPYDELPELRELVIAFGDAGYVALYRVIPS
ESAVLVLAFRHQREAGY
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|