Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 1190989..1191629 | Replicon | chromosome |
Accession | NZ_LR590482 | ||
Organism | Pseudomonas synxantha strain NCTC10696 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | - |
Locus tag | FGL41_RS05520 | Protein ID | WP_043050338.1 |
Coordinates | 1191216..1191629 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | - |
Locus tag | FGL41_RS05515 | Protein ID | WP_043050337.1 |
Coordinates | 1190989..1191219 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FGL41_RS05495 | 1187252..1188211 | + | 960 | WP_057023887.1 | LysR family transcriptional regulator | - |
FGL41_RS05500 | 1188304..1188951 | - | 648 | WP_057023888.1 | HAD-IB family hydrolase | - |
FGL41_RS05505 | 1189024..1189185 | - | 162 | Protein_1057 | HNH endonuclease | - |
FGL41_RS05510 | 1189260..1190510 | - | 1251 | WP_057023889.1 | ribonucleotide-diphosphate reductase subunit beta | - |
FGL41_RS05515 | 1190989..1191219 | + | 231 | WP_043050337.1 | virulence factor | Antitoxin |
FGL41_RS05520 | 1191216..1191629 | + | 414 | WP_043050338.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
FGL41_RS05525 | 1191787..1192056 | - | 270 | WP_046069194.1 | DUF2790 domain-containing protein | - |
FGL41_RS05530 | 1192454..1194409 | + | 1956 | WP_057023890.1 | acetate--CoA ligase | - |
FGL41_RS05535 | 1195091..1195876 | + | 786 | WP_057013611.1 | ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 15127.45 Da Isoelectric Point: 7.1890
>T288490 WP_043050338.1 NZ_LR590482:1191216-1191629 [Pseudomonas synxantha]
VTTYMLDTCICSFIMRERPECVLERLALEVARSNRIVISAITYAEMRYGQIGKKASPKHKTLVDEFVKRLDEVLPWGLAA
VDATVEVKRSLTGQGSIIGQNDTAIAGHAIAAGCTLVTNNVREFSRVAGLSYEDWVH
VTTYMLDTCICSFIMRERPECVLERLALEVARSNRIVISAITYAEMRYGQIGKKASPKHKTLVDEFVKRLDEVLPWGLAA
VDATVEVKRSLTGQGSIIGQNDTAIAGHAIAAGCTLVTNNVREFSRVAGLSYEDWVH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|