Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2303729..2304323 | Replicon | chromosome |
| Accession | NZ_LR590480 | ||
| Organism | Bordetella parapertussis strain NCTC10522 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | K0M8J0 |
| Locus tag | FGL40_RS10885 | Protein ID | WP_010928352.1 |
| Coordinates | 2304141..2304323 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | K0MFV7 |
| Locus tag | FGL40_RS10880 | Protein ID | WP_010928351.1 |
| Coordinates | 2303729..2304118 (-) | Length | 130 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FGL40_RS10855 | 2299572..2300612 | + | 1041 | WP_003809635.1 | phosphate ABC transporter substrate-binding protein PstS | - |
| FGL40_RS10860 | 2300747..2301763 | + | 1017 | WP_010928350.1 | phosphate ABC transporter permease subunit PstC | - |
| FGL40_RS10865 | 2301785..2302642 | + | 858 | WP_003809638.1 | phosphate ABC transporter permease PstA | - |
| FGL40_RS10870 | 2302687..2303463 | + | 777 | WP_033448479.1 | phosphate ABC transporter ATP-binding protein PstB | - |
| FGL40_RS10880 | 2303729..2304118 | - | 390 | WP_010928351.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| FGL40_RS10885 | 2304141..2304323 | - | 183 | WP_010928352.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| FGL40_RS10890 | 2304731..2305429 | + | 699 | WP_003809653.1 | gluconate 2-dehydrogenase subunit 3 family protein | - |
| FGL40_RS10895 | 2305433..2307202 | + | 1770 | WP_010928353.1 | GMC family oxidoreductase | - |
| FGL40_RS10900 | 2307213..2308568 | + | 1356 | WP_003809657.1 | cytochrome c | - |
| FGL40_RS10905 | 2308580..2309320 | - | 741 | WP_003809659.1 | carbonic anhydrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6750.76 Da Isoelectric Point: 11.4018
>T288488 WP_010928352.1 NZ_LR590480:c2304323-2304141 [Bordetella parapertussis]
MNSTDLIQQPKADGWYRVHTVGSHHQYKHPTKPGKVTVPHPRKGLPTATQRSILKQAGLR
MNSTDLIQQPKADGWYRVHTVGSHHQYKHPTKPGKVTVPHPRKGLPTATQRSILKQAGLR
Download Length: 183 bp
Antitoxin
Download Length: 130 a.a. Molecular weight: 14270.92 Da Isoelectric Point: 4.3014
>AT288488 WP_010928351.1 NZ_LR590480:c2304118-2303729 [Bordetella parapertussis]
MLYPIHVSKDEGSAYGAAFPDFPGCFAAADELQDLPRAAQEAVEAHFYGETERIPAPSAPEAWANDEDYQGGYWMMVDID
LSKVNTKAVRLNISLPENLVHRIDEEAKARRLSRSAFLAMAAEHEMADA
MLYPIHVSKDEGSAYGAAFPDFPGCFAAADELQDLPRAAQEAVEAHFYGETERIPAPSAPEAWANDEDYQGGYWMMVDID
LSKVNTKAVRLNISLPENLVHRIDEEAKARRLSRSAFLAMAAEHEMADA
Download Length: 390 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|