Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 1582982..1583643 | Replicon | chromosome |
| Accession | NZ_LR590480 | ||
| Organism | Bordetella parapertussis strain NCTC10522 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | Q7WAH5 |
| Locus tag | FGL40_RS07410 | Protein ID | WP_003812073.1 |
| Coordinates | 1582982..1583407 (-) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | FGL40_RS07415 | Protein ID | WP_003812071.1 |
| Coordinates | 1583404..1583643 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FGL40_RS07390 | 1578796..1579773 | + | 978 | WP_003812083.1 | tripartite tricarboxylate transporter substrate binding protein | - |
| FGL40_RS07395 | 1579794..1580306 | - | 513 | WP_010928017.1 | hypothetical protein | - |
| FGL40_RS07400 | 1580805..1582310 | + | 1506 | WP_010928018.1 | tripartite tricarboxylate transporter permease | - |
| FGL40_RS07405 | 1582408..1582872 | - | 465 | WP_003812075.1 | MarR family transcriptional regulator | - |
| FGL40_RS07410 | 1582982..1583407 | - | 426 | WP_003812073.1 | PIN domain-containing protein | Toxin |
| FGL40_RS07415 | 1583404..1583643 | - | 240 | WP_003812071.1 | Arc family DNA-binding protein | Antitoxin |
| FGL40_RS07420 | 1583717..1584559 | - | 843 | WP_010928019.1 | AraC family transcriptional regulator | - |
| FGL40_RS07425 | 1584697..1585242 | + | 546 | WP_010928020.1 | peroxidase-related enzyme | - |
| FGL40_RS07430 | 1585301..1585813 | + | 513 | WP_003812062.1 | redoxin domain-containing protein | - |
| FGL40_RS07435 | 1585894..1586127 | + | 234 | WP_033447224.1 | DUF2945 domain-containing protein | - |
| FGL40_RS07440 | 1586124..1586684 | + | 561 | WP_010928021.1 | DUF488 domain-containing protein | - |
| FGL40_RS07445 | 1586762..1587808 | + | 1047 | WP_010928022.1 | Dyp-type peroxidase | - |
| FGL40_RS07450 | 1587805..1588608 | + | 804 | WP_003812055.1 | bacteriocin family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 14811.22 Da Isoelectric Point: 6.3704
>T288486 WP_003812073.1 NZ_LR590480:c1583407-1582982 [Bordetella parapertussis]
MILLDTDVLLEPLRPAPDPAVAAWLDAQHVETLYLAAPGAAEIQLGLARLPRGKRAEALRHEFERRVLPLFMGHVLPFDT
AAADAYAAVMMRAAAAGHALCAIDGCIAAIATAHGLAIATRHPARFEAAGLAAVDPWHAAA
MILLDTDVLLEPLRPAPDPAVAAWLDAQHVETLYLAAPGAAEIQLGLARLPRGKRAEALRHEFERRVLPLFMGHVLPFDT
AAADAYAAVMMRAAAAGHALCAIDGCIAAIATAHGLAIATRHPARFEAAGLAAVDPWHAAA
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|