Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1363915..1364551 | Replicon | chromosome |
Accession | NZ_LR590480 | ||
Organism | Bordetella parapertussis strain NCTC10522 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | Q7W5Z1 |
Locus tag | FGL40_RS06405 | Protein ID | WP_010928914.1 |
Coordinates | 1364369..1364551 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | Q7W5Z0 |
Locus tag | FGL40_RS06400 | Protein ID | WP_010928915.1 |
Coordinates | 1363915..1364307 (-) | Length | 131 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FGL40_RS06375 | 1359571..1359997 | - | 427 | Protein_1251 | OB-fold domain-containing protein | - |
FGL40_RS06380 | 1360001..1361173 | - | 1173 | WP_010928918.1 | thiolase domain-containing protein | - |
FGL40_RS06385 | 1361240..1361599 | - | 360 | WP_010928917.1 | hypothetical protein | - |
FGL40_RS06390 | 1361634..1362608 | - | 975 | WP_010928916.1 | tripartite tricarboxylate transporter substrate binding protein | - |
FGL40_RS06395 | 1362733..1363642 | + | 910 | Protein_1255 | LysR family transcriptional regulator | - |
FGL40_RS06400 | 1363915..1364307 | - | 393 | WP_010928915.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
FGL40_RS06405 | 1364369..1364551 | - | 183 | WP_010928914.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
FGL40_RS06415 | 1365100..1366320 | - | 1221 | WP_010928912.1 | ISL3-like element IS1001 family transposase | - |
FGL40_RS06425 | 1366895..1368082 | - | 1188 | WP_010928911.1 | MFS transporter | - |
FGL40_RS06430 | 1368300..1368977 | - | 678 | WP_010928910.1 | HAD-IA family hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1365100..1366320 | 1220 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6572.69 Da Isoelectric Point: 10.9062
>T288485 WP_010928914.1 NZ_LR590480:c1364551-1364369 [Bordetella parapertussis]
MDGKELIKQLERSGWTLRSVKGSHHVFAHPDRPGHISVPHPKKDLGIGLLNSILKAAGLK
MDGKELIKQLERSGWTLRSVKGSHHVFAHPDRPGHISVPHPKKDLGIGLLNSILKAAGLK
Download Length: 183 bp
Antitoxin
Download Length: 131 a.a. Molecular weight: 14058.82 Da Isoelectric Point: 4.2876
>AT288485 WP_010928915.1 NZ_LR590480:c1364307-1363915 [Bordetella parapertussis]
VKYPIAIEPGSDTRAWGVVVPDLPGCFSAADEGIDQAIENAKEAIELWIETAIDSGAPIPAATNIANHQANPEFANWIWA
IADVDPAVLDETVERVNITIPRRILKRLDDRARAAGESRSSYIAHLAMTA
VKYPIAIEPGSDTRAWGVVVPDLPGCFSAADEGIDQAIENAKEAIELWIETAIDSGAPIPAATNIANHQANPEFANWIWA
IADVDPAVLDETVERVNITIPRRILKRLDDRARAAGESRSSYIAHLAMTA
Download Length: 393 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|