Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 807451..808106 | Replicon | chromosome |
| Accession | NZ_LR590477 | ||
| Organism | Neisseria lactamica strain NCTC10617 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | D0W9J3 |
| Locus tag | FGL10_RS04260 | Protein ID | WP_003709029.1 |
| Coordinates | 807451..807870 (-) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | FGL10_RS04265 | Protein ID | WP_036469701.1 |
| Coordinates | 807870..808106 (-) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FGL10_RS04240 | 802684..804090 | - | 1407 | WP_036469720.1 | MFS transporter | - |
| FGL10_RS04245 | 804374..805153 | + | 780 | WP_003709035.1 | (Fe-S)-binding protein | - |
| FGL10_RS04250 | 805150..805851 | + | 702 | WP_003709033.1 | lactate utilization protein C | - |
| FGL10_RS04255 | 805848..807302 | + | 1455 | WP_003709031.1 | iron-sulfur cluster-binding protein | - |
| FGL10_RS04260 | 807451..807870 | - | 420 | WP_003709029.1 | type II toxin-antitoxin system toxin FitB | Toxin |
| FGL10_RS04265 | 807870..808106 | - | 237 | WP_036469701.1 | antitoxin | Antitoxin |
| FGL10_RS04270 | 808360..808803 | + | 444 | WP_003709023.1 | DNA cytosine methyltransferase | - |
| FGL10_RS04275 | 808918..809403 | - | 486 | WP_003709019.1 | 5-(carboxyamino)imidazole ribonucleotide mutase | - |
| FGL10_RS04280 | 809453..810166 | - | 714 | WP_003709018.1 | tol-pal system YbgF family protein | - |
| FGL10_RS04285 | 810166..810834 | - | 669 | WP_003709017.1 | O-methyltransferase | - |
| FGL10_RS04290 | 810845..811030 | - | 186 | WP_002216929.1 | DUF3460 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15455.90 Da Isoelectric Point: 6.7271
>T288484 WP_003709029.1 NZ_LR590477:c807870-807451 [Neisseria lactamica]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAMTVAELRLGVALLPDGKKKNVLHERLEQSILPLFARRILPFDE
PVAAIYAQIRSYAKTHGKAIAAADGYIAATAKQHRLTVATRDTGPFFAADVAVFNPWYD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAMTVAELRLGVALLPDGKKKNVLHERLEQSILPLFARRILPFDE
PVAAIYAQIRSYAKTHGKAIAAADGYIAATAKQHRLTVATRDTGPFFAADVAVFNPWYD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|