Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
| Location | 491944..492602 | Replicon | chromosome |
| Accession | NZ_LR590477 | ||
| Organism | Neisseria lactamica strain NCTC10617 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | D0WCQ5 |
| Locus tag | FGL10_RS02760 | Protein ID | WP_003711064.1 |
| Coordinates | 491944..492126 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | D0WCQ4 |
| Locus tag | FGL10_RS02765 | Protein ID | WP_003711063.1 |
| Coordinates | 492183..492602 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FGL10_RS02735 | 487282..488757 | + | 1476 | WP_003711071.1 | DUF3383 domain-containing protein | - |
| FGL10_RS02740 | 488821..489129 | + | 309 | WP_003711070.1 | hypothetical protein | - |
| FGL10_RS02745 | 489444..490226 | + | 783 | WP_003711068.1 | KilA-N domain-containing protein | - |
| FGL10_RS02750 | 490327..490767 | + | 441 | WP_003711067.1 | hypothetical protein | - |
| FGL10_RS02755 | 490897..491592 | - | 696 | Protein_495 | hypothetical protein | - |
| FGL10_RS02760 | 491944..492126 | + | 183 | WP_003711064.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| FGL10_RS02765 | 492183..492602 | + | 420 | WP_003711063.1 | transcriptional regulator | Antitoxin |
| FGL10_RS02770 | 492975..493151 | + | 177 | WP_021439769.1 | ribbon-helix-helix protein, CopG family | - |
| FGL10_RS11980 | 493155..493337 | + | 183 | WP_036470396.1 | hypothetical protein | - |
| FGL10_RS02780 | 493458..493838 | - | 381 | WP_003711060.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| FGL10_RS02785 | 493982..495193 | - | 1212 | WP_003711059.1 | tyrosine-type recombinase/integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 469286..574489 | 105203 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 7034.09 Da Isoelectric Point: 10.7562
>T288483 WP_003711064.1 NZ_LR590477:491944-492126 [Neisseria lactamica]
MKYSEFKRWLEARGVEFKSQKRGSHYNLRLGDKTSVFPFHGSREMGSDLTNKIKKDLGLK
MKYSEFKRWLEARGVEFKSQKRGSHYNLRLGDKTSVFPFHGSREMGSDLTNKIKKDLGLK
Download Length: 183 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15319.76 Da Isoelectric Point: 4.6289
>AT288483 WP_003711063.1 NZ_LR590477:492183-492602 [Neisseria lactamica]
MLNYPYILTPDSNGTFLVTFPDIPEAAAVGEDEETAAIEALDGLLCALDGYFDDRRPIPLPSMPKDGQYAVSLPALETAK
VLLLNEMLAQGVRKAEMARRLDVHMPQIDRLLDLRHNTKIDFLEKAAAKLGKKLNIALS
MLNYPYILTPDSNGTFLVTFPDIPEAAAVGEDEETAAIEALDGLLCALDGYFDDRRPIPLPSMPKDGQYAVSLPALETAK
VLLLNEMLAQGVRKAEMARRLDVHMPQIDRLLDLRHNTKIDFLEKAAAKLGKKLNIALS
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A378VJ58 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | D0WCQ4 |