Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4501959..4502576 | Replicon | chromosome |
| Accession | NZ_LR590469 | ||
| Organism | Yersinia enterocolitica subsp. enterocolitica strain NCTC12982 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | Q66DR5 |
| Locus tag | FGL26_RS21110 | Protein ID | WP_002208622.1 |
| Coordinates | 4501959..4502162 (-) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | Q6TU35 |
| Locus tag | FGL26_RS21115 | Protein ID | WP_005167670.1 |
| Coordinates | 4502208..4502576 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FGL26_RS21075 | 4497138..4497476 | + | 339 | WP_002208627.1 | P-II family nitrogen regulator | - |
| FGL26_RS21080 | 4497516..4498805 | + | 1290 | WP_005167660.1 | ammonium transporter AmtB | - |
| FGL26_RS21090 | 4499105..4499968 | - | 864 | WP_005167662.1 | acyl-CoA thioesterase II | - |
| FGL26_RS21095 | 4500226..4500756 | + | 531 | WP_005167665.1 | lipoprotein | - |
| FGL26_RS21100 | 4500808..4501113 | - | 306 | WP_032901164.1 | MGMT family protein | - |
| FGL26_RS21110 | 4501959..4502162 | - | 204 | WP_002208622.1 | expression modulating protein YmoA | Toxin |
| FGL26_RS21115 | 4502208..4502576 | - | 369 | WP_005167670.1 | Hha toxicity modulator TomB | Antitoxin |
| FGL26_RS21120 | 4502734..4503087 | - | 354 | WP_005167672.1 | hypothetical protein | - |
| FGL26_RS21130 | 4503858..4504586 | + | 729 | WP_032902542.1 | ABC transporter ATP-binding protein | - |
| FGL26_RS21135 | 4504583..4505440 | + | 858 | WP_005167676.1 | metal ABC transporter permease | - |
| FGL26_RS21140 | 4505486..4506364 | + | 879 | WP_005167678.1 | metal ABC transporter substrate-binding protein | - |
| FGL26_RS21145 | 4506491..4506634 | - | 144 | WP_002208618.1 | type B 50S ribosomal protein L36 | - |
| FGL26_RS21150 | 4506649..4506909 | - | 261 | WP_005163438.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8063.31 Da Isoelectric Point: 6.4573
>T288482 WP_002208622.1 NZ_LR590469:c4502162-4501959 [Yersinia enterocolitica subsp. enterocolitica]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14134.86 Da Isoelectric Point: 4.4085
>AT288482 WP_005167670.1 NZ_LR590469:c4502576-4502208 [Yersinia enterocolitica subsp. enterocolitica]
MDEYSPKRHDVAQLKFLCESLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYPDGGDLSELVEEYL
DDTYTLFSSYGINDPELQRWQKTKERLFRLFSGEYICTLMKT
MDEYSPKRHDVAQLKFLCESLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYPDGGDLSELVEEYL
DDTYTLFSSYGINDPELQRWQKTKERLFRLFSGEYICTLMKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|