Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 3928780..3929281 | Replicon | chromosome |
| Accession | NZ_LR590469 | ||
| Organism | Yersinia enterocolitica subsp. enterocolitica strain NCTC12982 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A8B6L013 |
| Locus tag | FGL26_RS18625 | Protein ID | WP_005175262.1 |
| Coordinates | 3929024..3929281 (+) | Length | 86 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A1JJ37 |
| Locus tag | FGL26_RS18620 | Protein ID | WP_005175264.1 |
| Coordinates | 3928780..3929034 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FGL26_RS18590 | 3924133..3925203 | + | 1071 | WP_005175277.1 | LPS export ABC transporter permease LptG | - |
| FGL26_RS18600 | 3925874..3927133 | + | 1260 | Protein_3522 | integrase arm-type DNA-binding domain-containing protein | - |
| FGL26_RS18605 | 3927268..3927582 | - | 315 | WP_005175269.1 | BrnA antitoxin family protein | - |
| FGL26_RS18610 | 3927569..3927850 | - | 282 | WP_005175267.1 | BrnT family toxin | - |
| FGL26_RS18620 | 3928780..3929034 | + | 255 | WP_005175264.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| FGL26_RS18625 | 3929024..3929281 | + | 258 | WP_005175262.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| FGL26_RS18630 | 3929493..3929843 | - | 351 | Protein_3527 | transcriptional regulator | - |
| FGL26_RS18635 | 3929848..3930210 | + | 363 | Protein_3528 | hypothetical protein | - |
| FGL26_RS18640 | 3930571..3930981 | + | 411 | WP_005159173.1 | GNAT family N-acetyltransferase | - |
| FGL26_RS18645 | 3931007..3931696 | + | 690 | WP_005175259.1 | PAS and helix-turn-helix domain-containing protein | - |
| FGL26_RS18650 | 3931733..3933040 | + | 1308 | WP_005175249.1 | cytosine permease | - |
| FGL26_RS18655 | 3933090..3933675 | + | 586 | Protein_3532 | HEAT repeat domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 10105.79 Da Isoelectric Point: 8.0296
>T288481 WP_005175262.1 NZ_LR590469:3929024-3929281 [Yersinia enterocolitica subsp. enterocolitica]
MTFNIDFDERALKEWHKLDKAIREQFKKKLRKLQENPYIESARLHGDLAGCFKIKLRASGFRLIYQVIDEEIVIWIVAVG
KLEDE
MTFNIDFDERALKEWHKLDKAIREQFKKKLRKLQENPYIESARLHGDLAGCFKIKLRASGFRLIYQVIDEEIVIWIVAVG
KLEDE
Download Length: 258 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B6L013 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A1JJ37 |