Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2438512..2439184 | Replicon | chromosome |
| Accession | NZ_LR590469 | ||
| Organism | Yersinia enterocolitica subsp. enterocolitica strain NCTC12982 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A7U7FIQ4 |
| Locus tag | FGL26_RS11620 | Protein ID | WP_005166047.1 |
| Coordinates | 2438512..2438937 (-) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A7U7FJE4 |
| Locus tag | FGL26_RS11625 | Protein ID | WP_004390965.1 |
| Coordinates | 2438918..2439184 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FGL26_RS11600 | 2434286..2434804 | + | 519 | WP_005173454.1 | flavodoxin FldB | - |
| FGL26_RS11605 | 2434863..2436284 | - | 1422 | WP_005173463.1 | cell envelope integrity protein CreD | - |
| FGL26_RS11610 | 2436376..2437803 | - | 1428 | WP_032909123.1 | two-component system sensor histidine kinase CreC | - |
| FGL26_RS11615 | 2437814..2438512 | - | 699 | WP_005173478.1 | two-component system response regulator CreB | - |
| FGL26_RS11620 | 2438512..2438937 | - | 426 | WP_005166047.1 | protein YgfX | Toxin |
| FGL26_RS11625 | 2438918..2439184 | - | 267 | WP_004390965.1 | FAD assembly factor SdhE | Antitoxin |
| FGL26_RS11630 | 2439579..2440571 | + | 993 | WP_005173484.1 | tRNA-modifying protein YgfZ | - |
| FGL26_RS11635 | 2440625..2441308 | - | 684 | WP_005173485.1 | hemolysin III family protein | - |
| FGL26_RS11640 | 2441539..2442141 | + | 603 | WP_005173488.1 | HD domain-containing protein | - |
| FGL26_RS11645 | 2442154..2442288 | - | 135 | Protein_2210 | SDR family oxidoreductase | - |
| FGL26_RS11650 | 2442327..2442764 | - | 438 | WP_005173494.1 | lipocalin-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 16425.21 Da Isoelectric Point: 9.8217
>T288478 WP_005166047.1 NZ_LR590469:c2438937-2438512 [Yersinia enterocolitica subsp. enterocolitica]
VAQWRCDLRISWHTQLFSLLAHGVLVTLTLVAPWPQGYTALWLVLLTLVVFECIRSQKNITSCQGEIRLKPGNIVLWKRH
EWVVIKQPWITRYGVLLSLQQTSSRSTRKRLWLAADSMSEEEWRQLCLLLRHSFGSDEGIN
VAQWRCDLRISWHTQLFSLLAHGVLVTLTLVAPWPQGYTALWLVLLTLVVFECIRSQKNITSCQGEIRLKPGNIVLWKRH
EWVVIKQPWITRYGVLLSLQQTSSRSTRKRLWLAADSMSEEEWRQLCLLLRHSFGSDEGIN
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U7FIQ4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U7FJE4 |