Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 2010965..2011500 | Replicon | chromosome |
| Accession | NZ_LR590469 | ||
| Organism | Yersinia enterocolitica subsp. enterocolitica strain NCTC12982 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A8B6KW45 |
| Locus tag | FGL26_RS09535 | Protein ID | WP_005172322.1 |
| Coordinates | 2010965..2011252 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A8B6KUS5 |
| Locus tag | FGL26_RS09540 | Protein ID | WP_005172325.1 |
| Coordinates | 2011249..2011500 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FGL26_RS09515 | 2006378..2007061 | - | 684 | WP_032902930.1 | response regulator transcription factor | - |
| FGL26_RS09520 | 2007861..2010140 | - | 2280 | WP_005172316.1 | NADP-dependent oxaloacetate-decarboxylating malate dehydrogenase | - |
| FGL26_RS09530 | 2010361..2010936 | - | 576 | WP_005172319.1 | GDP-mannose pyrophosphatase NudK | - |
| FGL26_RS09535 | 2010965..2011252 | - | 288 | WP_005172322.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| FGL26_RS09540 | 2011249..2011500 | - | 252 | WP_005172325.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| FGL26_RS09545 | 2011777..2012376 | - | 600 | WP_005172326.1 | cytochrome c-type protein NapC | - |
| FGL26_RS09550 | 2012404..2012871 | - | 468 | WP_005165692.1 | nitrate reductase cytochrome c-type subunit | - |
| FGL26_RS09555 | 2012942..2015437 | - | 2496 | WP_011815828.1 | nitrate reductase catalytic subunit NapA | - |
| FGL26_RS09560 | 2015434..2015700 | - | 267 | WP_005165688.1 | chaperone NapD | - |
| FGL26_RS09565 | 2015690..2016193 | - | 504 | WP_005172332.1 | ferredoxin-type protein NapF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | acrB | 2007505..2053802 | 46297 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11076.06 Da Isoelectric Point: 10.6907
>T288477 WP_005172322.1 NZ_LR590469:c2011252-2010965 [Yersinia enterocolitica subsp. enterocolitica]
MTYIVKFRDEALKEWHKLDKTIQQQFAKKLKKCSENPHIESARLRGIKNGYKIKLRASGFRLVYEVIDGILVVAVVAVGK
RERSEVYKLASDRLR
MTYIVKFRDEALKEWHKLDKTIQQQFAKKLKKCSENPHIESARLRGIKNGYKIKLRASGFRLVYEVIDGILVVAVVAVGK
RERSEVYKLASDRLR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B6KW45 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B6KUS5 |