Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1206173..1206810 | Replicon | chromosome |
| Accession | NZ_LR590469 | ||
| Organism | Yersinia enterocolitica subsp. enterocolitica strain NCTC12982 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | FGL26_RS05630 | Protein ID | WP_005170069.1 |
| Coordinates | 1206406..1206810 (+) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A0T9QJI8 |
| Locus tag | FGL26_RS05625 | Protein ID | WP_005170066.1 |
| Coordinates | 1206173..1206406 (+) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FGL26_RS05605 | 1203433..1203729 | + | 297 | WP_005170044.1 | NINE protein | - |
| FGL26_RS05610 | 1204000..1205077 | + | 1078 | Protein_1062 | phage tail protein | - |
| FGL26_RS05620 | 1205077..1205691 | + | 615 | WP_005170056.1 | tail fiber assembly protein | - |
| FGL26_RS05625 | 1206173..1206406 | + | 234 | WP_005170066.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| FGL26_RS05630 | 1206406..1206810 | + | 405 | WP_005170069.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| FGL26_RS21405 | 1207420..1207596 | + | 177 | WP_005170072.1 | hypothetical protein | - |
| FGL26_RS05635 | 1207802..1208686 | + | 885 | WP_072075853.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
| FGL26_RS05640 | 1208946..1209747 | - | 802 | Protein_1068 | IS3 family transposase | - |
| FGL26_RS05645 | 1209968..1210264 | - | 297 | WP_002211830.1 | integration host factor subunit alpha | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14907.16 Da Isoelectric Point: 7.4667
>T288471 WP_005170069.1 NZ_LR590469:1206406-1206810 [Yersinia enterocolitica subsp. enterocolitica]
MHKYMLDTNIVIYVIKRRPIEVLGRFNANAGRMVISSITLAELLHGVEKSAAPERNLSVVEDFVSRLTVLDYDDKAAIHY
GSIRASLEQKGTPIGVNDLHIAGHARSTGLILVTNNRKEFDRVPGLIVDNWLGE
MHKYMLDTNIVIYVIKRRPIEVLGRFNANAGRMVISSITLAELLHGVEKSAAPERNLSVVEDFVSRLTVLDYDDKAAIHY
GSIRASLEQKGTPIGVNDLHIAGHARSTGLILVTNNRKEFDRVPGLIVDNWLGE
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|