Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 269325..269937 | Replicon | chromosome |
Accession | NZ_LR590466 | ||
Organism | Streptococcus pyogenes strain NCTC8193 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A4Z2JY48 |
Locus tag | FGK81_RS01320 | Protein ID | WP_002982731.1 |
Coordinates | 269325..269660 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q5X9X9 |
Locus tag | FGK81_RS01325 | Protein ID | WP_002988079.1 |
Coordinates | 269650..269937 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FGK81_RS01285 | 264675..265193 | + | 519 | WP_011889154.1 | NYN domain-containing protein | - |
FGK81_RS01290 | 265290..266150 | + | 861 | WP_011889153.1 | DegV family protein | - |
FGK81_RS01295 | 266286..266792 | + | 507 | WP_002988070.1 | hypothetical protein | - |
FGK81_RS01300 | 266789..266995 | + | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
FGK81_RS01305 | 267213..267659 | + | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
FGK81_RS01310 | 267680..268072 | + | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
FGK81_RS09905 | 268192..268740 | - | 549 | WP_136115776.1 | site-specific integrase | - |
FGK81_RS09910 | 268703..269173 | - | 471 | WP_021733374.1 | site-specific integrase | - |
FGK81_RS01320 | 269325..269660 | - | 336 | WP_002982731.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
FGK81_RS01325 | 269650..269937 | - | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
FGK81_RS01330 | 270587..271360 | - | 774 | WP_002982738.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
FGK81_RS01335 | 271806..272234 | + | 429 | WP_002982747.1 | galactose-6-phosphate isomerase subunit LacA | - |
FGK81_RS01340 | 272269..272784 | + | 516 | WP_011889152.1 | galactose-6-phosphate isomerase subunit LacB | - |
FGK81_RS01345 | 272832..273761 | + | 930 | WP_011889151.1 | tagatose-6-phosphate kinase | - |
FGK81_RS01350 | 273765..274748 | + | 984 | WP_011889150.1 | tagatose-bisphosphate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13145.88 Da Isoelectric Point: 5.2144
>T288467 WP_002982731.1 NZ_LR590466:c269660-269325 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4Z2JY48 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4U7GX94 |