Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 242243..242847 | Replicon | chromosome |
Accession | NZ_LR590465 | ||
Organism | Haemophilus influenzae strain NCTC8468 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q9S658 |
Locus tag | FGK83_RS01240 | Protein ID | WP_042593918.1 |
Coordinates | 242539..242847 (+) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | FGK83_RS01235 | Protein ID | WP_138171472.1 |
Coordinates | 242243..242539 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FGK83_RS01220 | 238009..239394 | + | 1386 | WP_138171470.1 | L-seryl-tRNA(Sec) selenium transferase | - |
FGK83_RS01225 | 239391..241250 | + | 1860 | WP_138171471.1 | selenocysteine-specific translation elongation factor | - |
FGK83_RS01230 | 241269..242123 | + | 855 | WP_050823021.1 | DUF3298 domain-containing protein | - |
FGK83_RS01235 | 242243..242539 | + | 297 | WP_138171472.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
FGK83_RS01240 | 242539..242847 | + | 309 | WP_042593918.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
FGK83_RS01245 | 242904..246110 | - | 3207 | WP_138171473.1 | TonB-dependent hemoglobin/transferrin/lactoferrin family receptor | - |
FGK83_RS01250 | 246440..247738 | + | 1299 | WP_138171474.1 | trigger factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11921.67 Da Isoelectric Point: 7.2393
>T288463 WP_042593918.1 NZ_LR590465:242539-242847 [Haemophilus influenzae]
MSEEKPLKVSYSKQFVRDLTDLAKRSPNVLIGSKYITAIYCLLNRLPLPENYQDHALVGEWKGYRDCHIQGDLVLIYQYV
IQDEFDELKFSRLNTHSQTALK
MSEEKPLKVSYSKQFVRDLTDLAKRSPNVLIGSKYITAIYCLLNRLPLPENYQDHALVGEWKGYRDCHIQGDLVLIYQYV
IQDEFDELKFSRLNTHSQTALK
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|