Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | VapXD/- |
Location | 180080..180558 | Replicon | chromosome |
Accession | NZ_LR590465 | ||
Organism | Haemophilus influenzae strain NCTC8468 |
Toxin (Protein)
Gene name | VapD | Uniprot ID | A0A0K9L551 |
Locus tag | FGK83_RS00930 | Protein ID | WP_050848517.1 |
Coordinates | 180080..180358 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | VapX | Uniprot ID | A0A0K9KX05 |
Locus tag | FGK83_RS00935 | Protein ID | WP_012055040.1 |
Coordinates | 180367..180558 (-) | Length | 64 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FGK83_RS00910 | 175270..176940 | - | 1671 | WP_138171441.1 | fructose-specific PTS transporter subunit EIIC | - |
FGK83_RS00915 | 176942..177883 | - | 942 | WP_138171442.1 | 1-phosphofructokinase | - |
FGK83_RS00920 | 177885..179384 | - | 1500 | WP_138171443.1 | fused PTS fructose transporter subunit IIA/HPr protein | - |
FGK83_RS00925 | 179454..179984 | - | 531 | WP_162632261.1 | hypothetical protein | - |
FGK83_RS00930 | 180080..180358 | - | 279 | WP_050848517.1 | virulence-associated protein VapD | Toxin |
FGK83_RS00935 | 180367..180558 | - | 192 | WP_012055040.1 | DUF5397 family protein | Antitoxin |
FGK83_RS00940 | 180629..181927 | - | 1299 | WP_050846548.1 | hemolysin family protein | - |
FGK83_RS00945 | 181978..182502 | - | 525 | WP_005669286.1 | DUF1523 family protein | - |
FGK83_RS00950 | 182529..183311 | - | 783 | WP_138171444.1 | YchF/TatD family DNA exonuclease | - |
FGK83_RS00955 | 183350..184330 | - | 981 | WP_138171445.1 | DNA polymerase III subunit delta' | - |
FGK83_RS00960 | 184327..184959 | - | 633 | WP_171007187.1 | dTMP kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10604.98 Da Isoelectric Point: 5.7408
>T288462 WP_050848517.1 NZ_LR590465:c180358-180080 [Haemophilus influenzae]
MYAIAFDLVVKDTQDYHPKGVQQAYTDIGAVLAKFGFVRTQGSLYTNTNEDMANLFQAMNSLKQLAWISQSVRDIRAFRI
EQWSDFTDFIRS
MYAIAFDLVVKDTQDYHPKGVQQAYTDIGAVLAKFGFVRTQGSLYTNTNEDMANLFQAMNSLKQLAWISQSVRDIRAFRI
EQWSDFTDFIRS
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K9L551 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K9KX05 |