Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4648794..4649310 | Replicon | chromosome |
| Accession | NZ_LR588412 | ||
| Organism | Klebsiella pneumoniae strain NCTC9157 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A085DK79 |
| Locus tag | FGL27_RS22745 | Protein ID | WP_009309309.1 |
| Coordinates | 4648794..4649078 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | FGL27_RS22750 | Protein ID | WP_002886901.1 |
| Coordinates | 4649068..4649310 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FGL27_RS22725 | 4644270..4644578 | - | 309 | WP_012737232.1 | PTS sugar transporter subunit IIB | - |
| FGL27_RS26295 | 4644663..4644836 | + | 174 | WP_032408826.1 | hypothetical protein | - |
| FGL27_RS22730 | 4644839..4645582 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| FGL27_RS22735 | 4645939..4648077 | + | 2139 | WP_004222153.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| FGL27_RS22740 | 4648326..4648790 | + | 465 | WP_004192393.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| FGL27_RS22745 | 4648794..4649078 | - | 285 | WP_009309309.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| FGL27_RS22750 | 4649068..4649310 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| FGL27_RS22755 | 4649388..4651298 | - | 1911 | WP_004152270.1 | BglG family transcription antiterminator | - |
| FGL27_RS22760 | 4651321..4652475 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
| FGL27_RS22765 | 4652542..4653282 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11141.99 Da Isoelectric Point: 10.3787
>T288460 WP_009309309.1 NZ_LR588412:c4649078-4648794 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A085DK79 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |