Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3918186..3918805 Replicon chromosome
Accession NZ_LR588412
Organism Klebsiella pneumoniae strain NCTC9157

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag FGL27_RS19300 Protein ID WP_002892050.1
Coordinates 3918587..3918805 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag FGL27_RS19295 Protein ID WP_002892066.1
Coordinates 3918186..3918560 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FGL27_RS19285 3913338..3914531 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
FGL27_RS19290 3914554..3917700 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
FGL27_RS19295 3918186..3918560 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
FGL27_RS19300 3918587..3918805 + 219 WP_002892050.1 hemolysin expression modulator Hha Toxin
FGL27_RS19305 3918964..3919530 + 567 WP_002892030.1 maltose O-acetyltransferase -
FGL27_RS26150 3919502..3919642 - 141 WP_004147370.1 hypothetical protein -
FGL27_RS19310 3919663..3920133 + 471 WP_002892026.1 YlaC family protein -
FGL27_RS19315 3920108..3921559 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
FGL27_RS19320 3921660..3922358 + 699 WP_002892021.1 GNAT family N-acetyltransferase -
FGL27_RS19325 3922355..3922495 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
FGL27_RS19330 3922495..3922758 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T288458 WP_002892050.1 NZ_LR588412:3918587-3918805 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT288458 WP_002892066.1 NZ_LR588412:3918186-3918560 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References