Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 2889011..2889630 Replicon chromosome
Accession NZ_LR588411
Organism Klebsiella quasipneumoniae strain NCTC9170

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag FGL28_RS14070 Protein ID WP_002892050.1
Coordinates 2889011..2889229 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag FGL28_RS14075 Protein ID WP_002892066.1
Coordinates 2889256..2889630 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FGL28_RS14040 2885055..2885318 + 264 WP_004204754.1 type B 50S ribosomal protein L31 -
FGL28_RS14045 2885318..2885458 + 141 WP_002892018.1 type B 50S ribosomal protein L36 -
FGL28_RS14050 2885455..2886153 - 699 WP_004204753.1 GNAT family N-acetyltransferase -
FGL28_RS14055 2886254..2887711 + 1458 WP_122543503.1 PLP-dependent aminotransferase family protein -
FGL28_RS14060 2887680..2888150 - 471 WP_049093338.1 YlaC family protein -
FGL28_RS25440 2888193..2888315 + 123 WP_162994670.1 hypothetical protein -
FGL28_RS14065 2888287..2888853 - 567 WP_004204750.1 maltose O-acetyltransferase -
FGL28_RS14070 2889011..2889229 - 219 WP_002892050.1 hemolysin expression modulator Hha Toxin
FGL28_RS14075 2889256..2889630 - 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
FGL28_RS14080 2890115..2893261 - 3147 WP_017898892.1 multidrug efflux RND transporter permease subunit -
FGL28_RS14085 2893284..2894477 - 1194 WP_004204747.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T288443 WP_002892050.1 NZ_LR588411:c2889229-2889011 [Klebsiella quasipneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT288443 WP_002892066.1 NZ_LR588411:c2889630-2889256 [Klebsiella quasipneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References