Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 2200694..2201207 | Replicon | chromosome |
Accession | NZ_LR588411 | ||
Organism | Klebsiella quasipneumoniae strain NCTC9170 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A663BE04 |
Locus tag | FGL28_RS10780 | Protein ID | WP_017900571.1 |
Coordinates | 2200926..2201207 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | FGL28_RS10775 | Protein ID | WP_002886901.1 |
Coordinates | 2200694..2200936 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FGL28_RS10760 | 2196724..2197464 | + | 741 | WP_004206507.1 | KDGP aldolase family protein | - |
FGL28_RS10765 | 2197532..2198683 | + | 1152 | WP_017900573.1 | lactonase family protein | - |
FGL28_RS10770 | 2198706..2200616 | + | 1911 | WP_004206509.1 | BglG family transcription antiterminator | - |
FGL28_RS10775 | 2200694..2200936 | + | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
FGL28_RS10780 | 2200926..2201207 | + | 282 | WP_017900571.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
FGL28_RS10785 | 2201211..2201675 | - | 465 | WP_032456904.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
FGL28_RS10790 | 2201974..2202285 | - | 312 | WP_109938332.1 | hypothetical protein | - |
FGL28_RS10795 | 2202412..2204550 | - | 2139 | WP_004206513.1 | anaerobic ribonucleoside-triphosphate reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11082.93 Da Isoelectric Point: 10.4123
>T288442 WP_017900571.1 NZ_LR588411:2200926-2201207 [Klebsiella quasipneumoniae]
MTYELEFDPRAWREWQLGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDRVVVVYVIAIGKR
EKAAVYHQANKRL
MTYELEFDPRAWREWQLGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDRVVVVYVIAIGKR
EKAAVYHQANKRL
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A663BE04 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |