Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 876299..876956 | Replicon | chromosome |
| Accession | NZ_LR588411 | ||
| Organism | Klebsiella quasipneumoniae strain NCTC9170 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A2A5MNX1 |
| Locus tag | FGL28_RS04270 | Protein ID | WP_004205323.1 |
| Coordinates | 876299..876709 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | FGL28_RS04275 | Protein ID | WP_002916312.1 |
| Coordinates | 876690..876956 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FGL28_RS04250 | 872299..874032 | - | 1734 | WP_004205327.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| FGL28_RS04255 | 874038..874751 | - | 714 | WP_004205326.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| FGL28_RS04260 | 874774..875670 | - | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| FGL28_RS04265 | 875771..876292 | + | 522 | WP_004205324.1 | flavodoxin FldB | - |
| FGL28_RS04270 | 876299..876709 | - | 411 | WP_004205323.1 | protein YgfX | Toxin |
| FGL28_RS04275 | 876690..876956 | - | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| FGL28_RS04280 | 877202..878185 | + | 984 | WP_122542307.1 | tRNA-modifying protein YgfZ | - |
| FGL28_RS04285 | 878284..878943 | - | 660 | WP_004205319.1 | hemolysin III family protein | - |
| FGL28_RS04290 | 879106..879417 | - | 312 | WP_004205318.1 | N(4)-acetylcytidine aminohydrolase | - |
| FGL28_RS04295 | 879467..880195 | + | 729 | WP_004205316.1 | MurR/RpiR family transcriptional regulator | - |
| FGL28_RS04300 | 880314..881747 | + | 1434 | WP_004205314.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16035.83 Da Isoelectric Point: 11.4778
>T288441 WP_004205323.1 NZ_LR588411:c876709-876299 [Klebsiella quasipneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
DWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
DWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2A5MNX1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |